DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gapvd1 and Gapvd1

Sequence 1:NP_572704.1 Gene:Gapvd1 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:XP_006224431.1 Gene:Gapvd1 RGDID:1307479 Length:1484 Species:Rattus norvegicus

Alignment Length:1815 Identity:480/1816 (26%)
Similarity:773/1816 (43%) Gaps:452/1816 (25%)


  Fly    10 LEIMDLARTLRQEQLFIQQEQAAFAQLTGAFESNAGTITKLAFVCAQQRQILNELLLARTDQDPL 74
            |:|..||..|:||:|::..|:....:|.......|..:.:.|::..|||..|:.|::...:..|.
  Rat     4 LDIHTLAHHLKQERLYVSSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLIITSAEASPA 68

  Fly    75 LFCRRASAYDSAQFVDAKQLLPYEHALAYEDLFNYLYNTPYLLALSLATADRLSLLSASQLGQII 139
            ..|:.|...:..||||..:.|.::.. ||.:..:.|...|.|:|.||...::   |:......:|
  Rat    69 ECCQHAKILEDTQFVDGYKQLGFQET-AYGEFLSRLRENPRLIASSLVAGEK---LNQENTQSVI 129

  Fly   140 NTIATGLYGNAINTKDVELLLKLLRELIEIQLLTSEQPRRLLRTNSSSFARLYQRLVESLFSARI 204
            .|:.|.||||.|..:|...||::||.|||.:|..|:.||||||..:.:|:.|::...|.||||::
  Rat   130 YTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSILFKLFSEGLFSAKL 194

  Fly   205 FLTAALHAPLMGVLSEHEIWLDLDPHKLMQTFTPKEREKRFGREGDEEYQRNVARFHAETLGKLH 269
            ||||.||.|:|.:|.|.|..|:.||:||::.|:|.::||.||.:|.:.:::.|.........||.
  Rat   195 FLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPAQQEKLFGEKGSDRFRQKVQEMVDSNEAKLV 259

  Fly   270 SHVQEFVKSLQQSWALFPSSLRWLLQTLSQQLRQSLRHEEQEIRQLLTDLVFTHFISPAIASADL 334
            :.|.:|:..|:|:...||.||||::..:.:.|....|.|..|:|.:.|||:...||.||:.:.:.
  Rat   260 ALVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVGEVRAMCTDLLLACFICPAVVNPEQ 324

  Fly   335 LGII-DVNVSERMRHNLNQIVKLLQRLAL-NDEDSE--------------LVQLMELLMLGQTGE 383
            .||| |..::|..|.||.|:.:|||:||: ..|:.:              :...:::::.|:..|
  Rat   325 YGIISDAPINEVARFNLMQVGRLLQQLAMTGTEEGDPRTKNSLGKFDKGCVAAFLDVVIGGRAVE 389

  Fly   384 DVVAILPQQSD------FERSQLAINQRELAQLVEFFRLLTARDEYDISVEERQRLQRILGRIPK 442
                 .|..|.      ..|:.:.|:..:|..||.|.:.:.:.|:..   |:|..|..:|..:|:
  Rat   390 -----TPPMSSVNLLEGLSRTVVYISYSQLITLVNFMKSVMSGDQLK---EDRMALDNLLANLPQ 446

  Fly   443 QQVQQQ---QQTPKDAPDSRESPEKSKKSNKSLMSLGKAKKKLAKGMSFSSGSSN---HNPVPVS 501
            .:..:.   ..||...|  :.||..:..:.|:.:.:|   ::||...::.|.::|   |  :|:.
  Rat   447 AKPGKSSSLDMTPYSTP--QMSPATTPANKKNRLPIG---QQLAAITAWDSSATNLTAH--IPLV 504

  Fly   502 EPLTNGQANTSNGSGGLGADLEHCSSHSGSNTSLSSCGANMPTTNDPLDMSTSSDPVLVFSLYNA 566
            .|......:.||....|..|      |.||:....              .....:.|||.||   
  Rat   505 TPFATRSRSRSNMLMDLHMD------HEGSSQETI--------------QEVQPEEVLVISL--- 546

  Fly   567 GAKSKLKP--LTEEEVLKMNSIGQDGSNLLPAVVTTAPLAPSSNNDDVSSLEAMRRPQDDASIG- 628
            |...:|.|  ::|.|||.| .:...|...:|.              |.:.|..  :|....... 
  Rat   547 GTGPQLTPGMMSENEVLNM-QLSDGGQGDVPV--------------DENKLHG--KPDKTLRFSL 594

  Fly   629 NSDNLEAISEA----AHSVASSLDLEEQQERDVHENEDNLSDMVSANVSGRGTPNISGRDTPSSQ 689
            .|||||.|||.    ::|| ||||||          .:::|::                      
  Rat   595 CSDNLEGISEGPSNRSNSV-SSLDLE----------GESVSEL---------------------- 626

  Fly   690 VTDGDGAGGDLGHHHGVHARAAANPQMQKMLLSKARSDIEDKFCKFELKKFEG---DENVS-IIS 750
               |.|..|.    :||.|.     |:.:...:..:.:::||..|||::...|   |.::| .:|
  Rat   627 ---GAGPSGS----NGVEAL-----QLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVS 679

  Fly   751 DTWSTDVLASDSENTLDATVSERGDRDRNF----STPLIPSAVVLPGDNNFVVEALARAGRVSGV 811
            :|||||||.||    .|..|.|  ||.:..    :..::.|.:.|||..:.:::....:      
  Rat   680 ETWSTDVLGSD----FDPNVDE--DRLQEIAGAAAENVLGSLLCLPGSGSVLLDPCTGS------ 732

  Fly   812 HGPQLDASDQRSESNWSTDVLASDS--------EKLAEIDTDDNVSITTKSDTTAPQAAVLDDDD 868
                 ..|:..||: ||.:||.|||        |:|.|:::...:..|:            ||.|
  Rat   733 -----TISETTSEA-WSVEVLPSDSEAPDLKQEERLQELESCSGLGSTS------------DDTD 779

  Fly   869 EDE-----QTPG---SSGDGEPDPDRGNGSE--RSQEDSAF--FDAVNSYEDANLYHGASSLARS 921
            ..|     .|||   .||......|..|..|  ||:..|.|  .|:|.|.:..::.|||..|   
  Rat   780 VREVSSRPSTPGLSVVSGISATSEDIPNKIEDLRSECSSDFGGKDSVTSPDVDDIAHGAHQL--- 841

  Fly   922 SVRTSYHVLGGESSFQQQYKCSGADSSGRKTTPLMGTSCMRRQTSAESSISNQSLNLEEPPPPMG 986
                                          |:|                 .:||.:|.....|:.
  Rat   842 ------------------------------TSP-----------------PSQSESLLAMFDPLS 859

  Fly   987 KHHHHHREHHHRDYHHHHRERERERERERSALKKKKHQQQEKEHRDLIDFSDCSEDKEELARNRD 1051
            .|                       |...:.::.|.|..                        |.
  Rat   860 SH-----------------------EGASAVVRPKVHYA------------------------RP 877

  Fly  1052 EEQPPGLVQQLLDMINQDEQTGAVSSSS---PNVEHRRISIEQRSAIIDGRRNGILAGSMRRHQS 1113
            ...||.  ..:|:        |||..:.   ||.....::..:..|.            .:||  
  Rat   878 SHPPPD--PPILE--------GAVGGNEARLPNFGSHVLTAAEMEAF------------RQRH-- 918

  Fly  1114 LNYENHEIMLNSMLPKTDDDKQEMLLCVQTQQLQLEERRGSAGLRPEVDGASGIAAAGGSGLKPP 1178
             :|....:...|         .:::.||:               ||..| .|.....|...| ||
  Rat   919 -SYPERLVRSRS---------SDIVSCVR---------------RPMSD-PSWNRRPGNEEL-PP 956

  Fly  1179 TKATG-----AIPKSISFDASADKDKQTYHRDGERDRERDRERER-DRERDRERDR--------- 1228
            ..|||     |.|.|.|...|.|..:      ||.:..:|.:.|| ||.|...|.|         
  Rat   957 AAATGATSLVAAPHSSSSSPSKDSSR------GETEERKDSDDERSDRSRPWWRKRFVSAMPKAP 1015

  Fly  1229 -------ERDRERDHHGAGIFNKLRQGIFKNRRGASAKNASNSSNQSNPAASTSSVQADIRSVSF 1286
                   ::::::|..|...|:.|                   :::.:|..   |.||.:     
  Rat  1016 IPFRKKEKQEKDKDDLGPDRFSTL-------------------TDEPSPRL---SAQAQV----- 1053

  Fly  1287 DPSAGCDNFGTHYCDTSEDILAKYR---RKVSSSSEATNSDSTGNGHGVGSTGSVGAAAHLHKHM 1348
                            :||||.|||   ::.|.|..|..:|.:....|.|.:........| ::|
  Rat  1054 ----------------AEDILDKYRNAIKRTSPSEGALANDESTEVMGDGESAHDSPREEL-QNM 1101

  Fly  1349 NGGHIP------------GVVFGCVKQKLRTVLSRTDLHSGDFRQTSTTSTTMATP--------- 1392
            :...:|            .:.:..||:|||..|...|  |..|... |.||....|         
  Rat  1102 SADDLPDSASQAAHPQDSALSYRDVKKKLRLALCSAD--SVAFPML-THSTRNGLPEHTDPEDNE 1163

  Fly  1393 LQIYLQIQLAQCISLQRLPQISHVAEALRCLAQLERPQHGQLLAELQRDLERRQSYLQYLMRHRQ 1457
            :..:|::|:|:.|:||....::.:.|.:||:.:.:.....:|||.:..|..:|..|:.||.|.||
  Rat  1164 IVCFLKVQIAEAINLQDKSLMAQLQETMRCVCRFDNRTCRKLLASIAEDYRKRAPYIAYLTRCRQ 1228

  Fly  1458 QLLLRSEQLEQLEARLRGEARSSQRCLLQALVRMYLAWSRQQEKLEQFQAEFAQLRASDERVELT 1522
            .|......||:|..|:..:...:.|......||:.|  ..:::|:.:|..:|.:|.|:|::....
  Rat  1229 GLQTTQAHLERLLQRVLRDKEVANRYFTTVCVRLLL--ESKEKKIREFIQDFQKLTAADDKTAQV 1291

  Fly  1523 EEFVESLLQELRSSADLQD--EWQVDAARVAIERMLLEQMYEQVMFPNEDADVSRDEVLSAHIGK 1585
            |:|::.|...:......|:  |.|:..|::||||.::.::::...:||:|.|:.||:||..||.:
  Rat  1292 EDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERSVMNRIFKLAFYPNQDGDILRDQVLHEHIQR 1356

  Fly  1586 LQRFVHPAHPALCIAQEYLGEAPWTFAQQQLCHMAAYKTPREKLQCIINCISSIMSLLRMSS-GR 1649
            |.:.|...|.||.|.:.||.||||..||.::..::||||||:|:|||:...|:||:||.::: ..
  Rat  1357 LSKVVTANHRALQIPEVYLREAPWPSAQSEIRTISAYKTPRDKVQCILRMCSTIMNLLSLANEDS 1421

  Fly  1650 VPAADDLLPVLIYVVIMANPPYLLSTVEYISCFLGKKLEGEDEFYWTLFGSVVKFIKTMD 1709
            ||.|||.:|||::|:|.||||.|||||:|||.|....|.||:.::|..|.:.|:||||:|
  Rat  1422 VPGADDFVPVLVFVLIKANPPCLLSTVQYISSFYASCLSGEESYWWMQFTAAVEFIKTID 1481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331 124/395 (31%)
VPS9 1609..1709 CDD:280383 51/101 (50%)
Gapvd1XP_006224431.1 RasGAP_RAP6 84..449 CDD:213331 123/390 (32%)
VPS9 1380..1481 CDD:280383 29/110 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C341110973
eggNOG 1 0.900 E2759_KOG2319
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 481 1.000 Inparanoid score I1384
OMA 1 1.010
OrthoDB 1 1.010 D196591at33208
OrthoFinder 1 1.000 FOG0005872
OrthoInspector 1 1.000 T1088841
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23101
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.