DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)10Bb and cwf14

DIOPT Version :8

Sequence 1:NP_511117.1 Gene:l(1)10Bb / 32069 FlyBaseID:FBgn0001491 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_595965.1 Gene:cwf14 / 2540434 PomBaseID:SPBC24C6.11 Length:146 Species:Schizosaccharomyces pombe

Alignment Length:144 Identity:87/145 (60%)
Similarity:113/145 (78%) Gaps:2/145 (1%)


  Fly     1 MPKVRRSR-KPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIFKIHHQKTRYIYDLF 64
            ||::|.|| |.||||::.|||||.|.:.:||:.|....:|.: ||.|.|||::|||::||||||:
pombe     1 MPRLRTSRTKRPPDGFDEIEPTLIEFQDRMRQIENTMGKGTK-TEMLAPIFQLHHQRSRYIYDLY 64

  Fly    65 YRRKAISRELYDYCLKEKIADGNLIAKWKKSGYENLCCLRCIQTRDTNFGTNCICRVPKCKLEEG 129
            |:|:|||.|||::.||:..|||||||||||.|||.|||||||||.::.||:.|||||||.||::.
pombe    65 YKREAISTELYNWLLKQNYADGNLIAKWKKPGYEKLCCLRCIQTAESKFGSTCICRVPKSKLDKD 129

  Fly   130 RIVECVHCGCRGCS 143
            :.|.|.||||.||:
pombe   130 QRVRCTHCGCNGCA 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(1)10BbNP_511117.1 G10 2..143 CDD:279469 86/142 (61%)
cwf14NP_595965.1 BUD31 1..146 CDD:227461 87/145 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2906
Inparanoid 1 1.050 191 1.000 Inparanoid score I1030
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004507
OrthoInspector 1 1.000 T1124400
orthoMCL 1 0.900 OOG5_128043
Panther 1 1.100 LDO PTHR19411
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R272
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.