DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir94h

DIOPT Version :8

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster

Alignment Length:663 Identity:139/664 (21%)
Similarity:238/664 (36%) Gaps:215/664 (32%)


  Fly    10 LFMLDLKTLNLTRLNGLLVEPT------RDLPQLELWLRAGSDHQDAENPYVQWFLLRTEIPLSI 68
            |:.|.||.|..:........||      ..||:..|     |:|     |.:.||...|...|  
  Fly    16 LYGLVLKFLVSSETTLFYFNPTGQKCSWETLPRTIL-----SNH-----PQIIWFREETYPGL-- 68

  Fly    69 VTYQENRYWMDDPFGRRNLVLVMSLD--------QLLTNRGAAAPIQKASTFFYILADQDKDLS- 124
              |:.:         ..||.::..|.        |||     |..:.:..:...::..|||:.| 
  Fly    69 --YKRH---------SSNLFVMACLSSTSYDGQLQLL-----AESLTRYRSVRVLIEVQDKEGSF 117

  Fly   125 -ADEQLRLEGSCRQLWTQHKVYN------RFFLTRDGVWIYDPFKRRDSAFGRLVRYYGSETLDK 182
             |.:.|.|   |:    ||.:.|      |:..|.: |:.|..|     .:.:|::...|.:|..
  Fly   118 LASQILLL---CQ----QHSMLNVVLYFSRWTRTLN-VFSYLAF-----PYFKLLKQRLSGSLRP 169

  Fly   183 LLF----RDMAGYPLRIQMFRSVYTRPEFDKETGLLTR-------VTGVDFLVAQMLRERLNFTM 236
            .:|    :|:.||.:|:|        |:.........|       |.|..:.:.:...:.|....
  Fly   170 KIFINQLKDLQGYKIRVQ--------PDLSPPNSFSYRDRHGECQVGGFLWRIVENFSKSLKGDT 226

  Fly   237 LLQQP--------EKKYFGERSANGSYNGAIGSIIKDGLDICLTGFFVKDYLVQQYMDFTVAVYD 293
            .:..|        ..:|..:.:.|||            .||.:|...:.....::|.|::..:||
  Fly   227 QVLYPTWAKAKVSAAEYMIQFTRNGS------------SDIGVTTTMITFKHEERYRDYSYPMYD 279

  Fly   294 DELCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALIWLTLRVINLKLRIVSLGNQHIVGQ 358
            ...|..:|...  |.|:        :|....||:..:..|:.|...:..|           ||.|
  Fly   280 ISWCTMLPVEK--PLSV--------EILFSHVLSPGSALLLILAFILFFL-----------IVPQ 323

  Fly   359 ---ALGIMVDTWVVWVRLNLSHLPASYAERMFIGTLC-LVSVIFGAIF----ESSLATVYIHPLY 415
               .|||                       .|.|.|. :.|.||..:.    .:.|.::.:.|..
  Fly   324 LIKCLGI-----------------------TFRGRLIGMASRIFALVMLCSSSAQLLSLLMSPPL 365

  Fly   416 YKDINTMQELDESGLKV------VY--------KYSS----------MADDLFFSETSPLFASLN 456
            :..|.:..:|..||||:      :|        ||:|          :.|:..:..||  :|...
  Fly   366 HTRIKSFDDLLTSGLKIFGIRSELYFLDGGFRAKYASAFHLTENPNELYDNRNYFNTS--WAYTI 428

  Fly   457 KKLSWNRDLRADVIDEVARFRNKA-GVSRYTSLILESSH--FTLLRKIWVVPECPKYYTISYVMP 518
            ..:.||      ||:  |:.|:.| .|.||::.:..||.  :.||    :.||            
  Fly   429 TSVKWN------VIE--AQQRHFAHPVFRYSTDLCFSSETPWGLL----IAPE------------ 469

  Fly   519 RDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVDIKMRSNILEAD-AESELVRVLTIGDLQ---L 579
              |.:.:.:....|:...||||.:|:  .:|:.::.....:...| :.:.|::.|.|.||:   :
  Fly   470 --SFYREPLQHFTLKINQAGLITQWM--TQSFHEMVRAGRMTIKDYSRTNLMKPLRIQDLRKCWV 530

  Fly   580 AFYVVIGGNLLAF 592
            .|.|.:|.:.:.|
  Fly   531 IFAVGLGTSTVVF 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 13/82 (16%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 19/104 (18%)
Lig_chan 319..587 CDD:278489 67/307 (22%)
Ir94hNP_651148.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.