DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir94g

DIOPT Version :8

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster

Alignment Length:296 Identity:56/297 (19%)
Similarity:114/297 (38%) Gaps:65/297 (22%)


  Fly   335 WLTLRVINLKLRIVSLGNQHIVGQALGIMVDTWVV-------WVRLNLSHLPASYAERMFIGTLC 392
            |.|:..:..:|.:..|..:.|....|.:::..|:.       |.|         ::....||.|.
  Fly   275 WCTMLPVERQLHVSELLTRVIPYPTLALLLLLWIFYEVLRGRWRR---------HSRLQSIGWLV 330

  Fly   393 LVSVIFGAIFESSLATVYIHPLYYKDINTMQELDESGLKVV---YKYSSMADDLFFSETSPLFAS 454
            |.::: .:.:...|..::..|.....:|::..|.||.::::   .:||::.    |::.:...| 
  Fly   331 LATLV-SSNYVGKLLNLFTDPPSLPPVNSLAALMESPVRIISIRSEYSAIE----FTQRTKYSA- 389

  Fly   455 LNKKLSWNRDLRADVIDEVARFRNKAGVSRYTSLILESSHFTLLRKIWVVPE------------- 506
                 :::..|.|.::   ...||....         |..:|:..:.|.:.|             
  Fly   390 -----AFHLALHASIL---IGLRNAFNT---------SYGYTITSEKWKIYEEQQKRSSKPVFRY 437

  Fly   507 ----CPKYYTI---SYVMPRDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVDIKMRSNILEADA 564
                |  :|.:   ..|:|.:||....:::..|....|||...|:....|:: :|.......|..
  Fly   438 SKDLC--FYEMIPFGLVIPENSPHRAPLHSYTLLLRQAGLHDFWVNRGFSYM-VKAGKINFTAVG 499

  Fly   565 ESELVRVLTIGDLQLAFYVVIGGNLLAFLGFLAEHF 600
            |....:.|||.||:..|.:.:...|::.:.|..|.|
  Fly   500 ERYEAKTLTITDLRNVFIIYVSVLLISLILFTCELF 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 14/83 (17%)
Lig_chan 319..587 CDD:278489 52/282 (18%)
Ir94gNP_651147.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.