DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir60e

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster


Alignment Length:484 Identity:93/484 - (19%)
Similarity:171/484 - (35%) Gaps:150/484 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SETLDKL-LFRDMAGYPLRIQMFRSVYTRPEFD--KETGLLTRVTGVDFLVAQMLRERLNFTM-- 236
            ||..|:. :.|:..|:|:||  .||.....:|:  .|.|.|.| .|..|...:.|..|.|.|:  
  Fly   171 SEYFDRARIIRNFQGFPVRI--LRSTLAPRDFEYSNEQGGLVR-AGYLFTAVKELTYRYNATIES 232

  Fly   237 --LLQQPE-------------KK-----YFGERSANGSYNGAIGSIIKDGLDICLTGFFVKDYLV 281
              :...||             ||     ||.:.|...:|...: |||::        :|:     
  Fly   233 VPIPDLPEYDVYLAVAEMLHTKKIDIVCYFKDFSLEVAYTAPL-SIIRE--------YFM----- 283

  Fly   282 QQYMDFTVAVYDDELCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALIWLTLRVINLKLR 346
                              .|.|..|...:......|:.:|          |::..|:....:.|.
  Fly   284 ------------------APHARPISSYLYYSKPFGWTLW----------AVVISTVLYGTVMLH 320

  Fly   347 IVSLGNQHIVGQALGIMVDTWVVWVRLNLSHL---------PASYAERMFIGTLCLVSVIFGAIF 402
            :.:.|.:..:|:.|           ..:|||:         .|.:.:....|.|.:...|...::
  Fly   321 LAARGARVEIGKCL-----------LYSLSHILYNCHQKIRVAGWRDVAIHGILTIGGFILTNVY 374

  Fly   403 ESSLATVYIHPLYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSP---LFASLNK-KLSWNR 463
            .::|:::....||.::.||:::|..:      .|.|:.|:.:.|:...   |...|.: .||.|.
  Fly   375 LATLSSILTSGLYDEEYNTLEDLARA------PYPSLHDEYYRSQMKAKTFLPERLRRNSLSLNA 433

  Fly   464 DLRADVIDEVARFRNKAGVSRYTSLILESSHFTLLRKIWVVPECPKYYTI---------SYVMPR 519
            .|       :..:|:  |:::....||......|:.....:.:.|::..|         ||.:..
  Fly   434 TL-------LKAYRD--GLNQSYIYILYEDRLELILMQQYLLKTPRFNMIRQAVGFTLESYCVSN 489

  Fly   520 DSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVDIKMRSNILEADAESELVR--VLTI-------- 574
            ..|:....:..:.|....|:.:|                 ::||...||:.  :.|:        
  Fly   490 SLPYLAMTSEFMRRLQEHGISIK-----------------MKADTFRELIHQGIYTLMRDDEPPA 537

  Fly   575 --GDLQLAFYVVI---GGNLLAFLGFLAE 598
              .||...|:..:   .|.:.:.|.|.||
  Fly   538 KAFDLDYYFFAFVLWTVGLISSLLVFFAE 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 17/95 (18%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 16/104 (15%)
Lig_chan 319..587 CDD:278489 51/304 (17%)
Ir60eNP_611927.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.