DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir94f

DIOPT Version :8

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster

Alignment Length:571 Identity:109/572 (19%)
Similarity:197/572 (34%) Gaps:180/572 (31%)


  Fly    34 LPQLELWLR--AGSDHQDA----ENPYVQWFLLRTEIPLSIVT------YQENRYWMDDPFGRRN 86
            |...:.|..  .|||:..|    :..|..:...|.:..:.:|:      |||..           
  Fly    40 LESCDCWFDNVLGSDNSTALLWNDQTYPHYLRRRQDTDILVVSCLRFHQYQEVL----------- 93

  Fly    87 LVLVMSLDQLLTNRGAAAPIQKASTFFYILADQDKDLSADEQLRLEGSCRQLWTQHK-------- 143
            |.|.:.|||:   |.....:|               |..||....|.:..:|..:|.        
  Fly    94 LALSLMLDQM---RSMPVVLQ---------------LCGDEDSMQELNSARLLLKHSQDLKMPNV 140

  Fly   144 -VYNRFFLTRDGVWIYDPFKRRDSAFGRLVRYYGSETLDKLLFRDMAGYPLRIQMFRSVYTRPEF 207
             :.:..|.|...::.|:.|.  :....:|| |....||......::.|:|:|        |.|: 
  Fly   141 VLLSSTFFTSATLYSYEMFP--EFNVQKLV-YQAYLTLFPYKLGNLKGHPIR--------TVPD- 193

  Fly   208 DKETGLLTRVT-----GVDFLVAQMLRE---RLNFTMLL---QQPEKKYFGERSANGSYNGAIGS 261
            :.|...:.|.|     .:|.||.|.:.|   .:|.|:.|   ..|||..               .
  Fly   194 NSEPLTIVRKTLNGSIAIDGLVWQFMIEFAKHINATLQLPIEPHPEKSI---------------K 243

  Fly   262 IIKDGLDICLTGFFVKDYLVQQYMDFTVAVYDDELCIYVPKASRIPQSILPIFAVGYDIWLGFVL 326
            :::           :.|.:..|.:|...::.        |.:..:.:|...|:  |..:.:|   
  Fly   244 LVQ-----------ILDLVRNQTVDIAASLR--------PYSLNVQRSSTHIY--GSPMMVG--- 284

  Fly   327 TAFACALIWLTLRVINLKLRIVSLGNQHIVG--QALGIMVD---TWVVWVRLNLSHLPASYAERM 386
                   .|..:           |..:.::|  :||..::.   ||::.:.....|...:...|:
  Fly   285 -------NWCMM-----------LPTERVIGSHEALTRLMKSPWTWLILLLFYSVHRFLAQKTRL 331

  Fly   387 FIGTLCLVSVIFG----AIFESSLATVYIHPLYYKDINTMQELDESGLKV--------------- 432
            ....:.|:.::..    ...::.|:..:|.|.....|:.||:::|||||:               
  Fly   332 RSSLIHLIKLLINLSLICFLQAQLSAYFIGPQKVNHISNMQQVEESGLKIRGMRGEFMEYPIDMR 396

  Fly   433 -VYKYSSMADDLFFSETSPLFASLNKKLSWN-RDLRADVIDEVAR-FRNKAGVSRYTS--LILES 492
             .|..|.:..|||| :.:....|||....:. ..::.::..|..| ||..  :.||:.  .:.:.
  Fly   397 SRYASSFLLHDLFF-DLAQYRNSLNTSYGYTVTSVKWELYKEAQRHFRRP--LFRYSEEICVQKL 458

  Fly   493 SHFTLLRKIWVVPECPKYYTISYVMPRDSPWEDAVNALLLRFLNAGLIVKW 543
            |.|:|:::    ..|...|              .....:||...||||..|
  Fly   459 SLFSLIQQ----SNCIYCY--------------RSRIFILRMHEAGLIRLW 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 14/80 (18%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 13/105 (12%)
Lig_chan 319..587 CDD:278489 49/255 (19%)
Ir94fNP_732868.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.