DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir67c

DIOPT Version :8

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_729609.1 Gene:Ir67c / 317838 FlyBaseID:FBgn0052058 Length:573 Species:Drosophila melanogaster

Alignment Length:603 Identity:113/604 (19%)
Similarity:204/604 (34%) Gaps:200/604 (33%)


  Fly   115 ILADQDKDLSA---------DEQLRLE--GSCRQLWTQ--HKVYNRFF-LTRDGVWIYDPFKR-- 163
            :|:|:.:..||         |:||:|.  ..|..:..|  .:|.|.|. .|.|.:.|...|..  
  Fly    12 LLSDRSESWSAREVIHQFNHDQQLQLNIYLDCNDVELQIGQEVSNLFVNSTADKMKILGRFSSHS 76

  Fly   164 ------RDSAFGRLVR-----YYGSETLDKLLFRD-----------------------MAG---- 190
                  :||...|.:.     .:|.:.|..|...|                       |.|    
  Fly    77 LIIACFKDSTRNRTLNGVKELLWGLQYLPILFVVDSNMDFYFQQALRHGFIHVLALNFMNGSLYT 141

  Fly   191 ---YPL----RIQMFRSVYTRPEFDKETGLLTRVTGVDFLVAQMLRER-----LNFTMLLQQPEK 243
               ||.    :|:..:..|...:.....|...|.| |:.:..:..|.|     |.:...:.:..|
  Fly   142 YKPYPKVEVHQIKDMQKFYKLTKLRNLQGQAVRTT-VETMTPRCFRYRNRHGQLVYAGYMYRMVK 205

  Fly   244 KYFGERSANGSYNGAIGSI----IKDGLDICLTG---------------FFVKDYLVQQYMDFTV 289
            ::..  :.||:.....|::    .|:||.....|               :|.:.::         
  Fly   206 EFIS--TYNGTEEHVFGNVDTVPYKEGLAALKNGEIDMMPRIIHALEWYYFYRSHI--------- 259

  Fly   290 AVYDDELCIYVPKASRIPQSILPIFAVGYDIWLGFVLT-AFACALIWLTLRVINLKLRIVSLGNQ 353
             :|:.:..|.||.|..:|:|:..|......:|:..::: .:|..:||.        :|....||.
  Fly   260 -LYNIKTYIMVPWAEPLPKSLYFIQPFRGTVWITIMVSFVYASIVIWW--------IRYRQQGNS 315

  Fly   354 HIVGQALGIMVDTWVVWVRLNLSHLPASYAERMFIGTLCLVSVIFGAIFESSLATVYIHP----- 413
            .:....:.::        :| |..||.|......:||..:||.|...:|...|..:|...     
  Fly   316 SLTQSFMDVL--------QL-LFQLPLSKIWHFNMGTHQVVSFIVLFVFGFMLTNLYTAQLSSYL 371

  Fly   414 ---LYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSPLFASLNKKLSWN--------RDLRA 467
               |:...|||.                  ||||..:.:.|..|.:.::..|        ::..:
  Fly   372 TTGLFKSQINTF------------------DDLFREKRTLLVESFDAEVLHNMTKEKIIQKEFES 418

  Fly   468 DV----IDEVARFRNKAGVS-----------------RYTSLILESSHFTLLRKIWVVPECPKYY 511
            .:    |:||.:.|.....|                 ||    |....|.:|::::  .:.|.:.
  Fly   419 IILITSIEEVFKHRKSLNTSYAYEAYEDRIAFELSQQRY----LRVPIFKILKEVY--DQRPVFV 477

  Fly   512 TISYVMPRDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVDIKMRSNILEADAESEL------VR 570
            .:.:.:    |:.:..|..|.|...:|:.:|..:|           :.||..|..|:      .|
  Fly   478 ALRHGL----PYVELFNNYLRRIFESGIWIKLQED-----------SFLEGIASGEISFRKSKSR 527

  Fly   571 VLTIGDLQLAF--YVVIG 586
            .:.|.|....|  |:::|
  Fly   528 EIKIFDKDFYFFAYILLG 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 14/98 (14%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 20/97 (21%)
Lig_chan 319..587 CDD:278489 59/315 (19%)
Ir67cNP_729609.1 Lig_chan 288..500 CDD:278489 46/257 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.