DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir7c

DIOPT Version :8

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster

Alignment Length:636 Identity:135/637 (21%)
Similarity:232/637 (36%) Gaps:191/637 (30%)


  Fly    58 FLL---RTEI--------PLSIVTYQENRYWMDDPFGRRNLVLVMSLDQLLTNRGAAAPIQKAST 111
            |||   |.|:        |.|.:|.:....|..|.. |....|.|.|:||      .:|.::...
  Fly    65 FLLEDDRVEMTETDTDPPPPSGLTGRPIAIWFLDSL-RSYFRLEMYLNQL------GSPYKRNGF 122

  Fly   112 FFYI---LADQDKDLSADEQLRLEGSCRQLWTQHKVYNRFFLTRDGV------WIYDPFKRRDSA 167
            |..|   |.||..     |.|::  ..|:|...:.:....||.|||.      :.|.|...:.| 
  Fly   123 FLVIYTGLEDQPM-----ESLKI--MFRRLLNMYVLNVNVFLQRDGTVHLYTYYPYGPHHCQSS- 179

  Fly   168 FGRLVRYYGSETLDKLLFRDMA----GYPLRIQMFRSVYT--------------RP----EFDKE 210
               |..||.:       |:|:|    |:.|...:|....|              ||    |.|.:
  Fly   180 ---LPVYYTA-------FQDLAAPANGFGLTKPLFPRKLTNMHGCEMVVATFEHRPYVIIEDDPK 234

  Fly   211 TGLLTRVTGVDFLVAQMLRERLNFTMLLQQPEKKYFGERSANGSYNGAIGSIIKDGLDICLTGFF 275
            |.....:.|::.|:.:.|.||:|||:.|.:.:.|..||...:|::.|.:..::...:::....|.
  Fly   235 TPGGRSIHGIEGLIFRSLAERMNFTIKLVEQKDKNRGEILPDGNFTGILKMMVDGEVNLTFVCFM 299

  Fly   276 V----KDYLV--QQYMDFTVAVYDDELCIYVPKASRIPQSILPIFAV----GYDIW--------L 322
            .    .|.::  ..|..|.:.       :.||...    ||.|:..:    .|.||        .
  Fly   300 YSKARSDLMLPSTSYTSFPIV-------LVVPSGG----SISPMGRLTRPFRYIIWSCILVSLIF 353

  Fly   323 GFVLTAF--ACALIWLTLRVINLKLRIVSLGNQHIVGQALGIMVDTWVVWVRLNLSHLPASYAER 385
            ||||...  ..||..|...|:..:.|:..:|                 :|..| |..|.....:|
  Fly   354 GFVLICLLKITALPGLRNLVLGRRNRLPFMG-----------------MWASL-LGGLALYNPQR 400

  Fly   386 MF---------IGTLCLVSVIFGAIFESSLATVYIHPLYYKDI---NTMQELDE----------- 427
            .|         :.||.|.:...|.::           |..:|:   :.::.|.|           
  Fly   401 NFARYILVMWLLQTLILRAAYTGQLY-----------LLLQDVEMRSPIKSLSEVLAKDYEFRIL 454

  Fly   428 SGLKVVYKYSSMADDLFFSETSPLFASLNKKLSWNRD------LRADVIDEVARFRNKAGVSRYT 486
            ..|:.::| .||....|.:     ..||.:.|...||      ..|.:...|.:|..::|.::  
  Fly   455 PALRTIFK-DSMPTTNFHA-----VLSLEESLYRLRDEDDPGITVALLQPTVNQFDFRSGPNK-- 511

  Fly   487 SLILESSHFTLLRKIWVVPECPKYYTISYVMPRDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWV 551
                        |.:.|:|:......:::.|...|.::..::.|::..:::|::.::   .|.::
  Fly   512 ------------RHLTVLPDPLMTAPLTFYMRPHSYFKRRIDRLIMAMMSSGIVARY---RKMYM 561

  Fly   552 D----IKMRSNILEADAESELVRVLTIGDLQLAFYVVIGGNLLAFLGFLAE 598
            |    :..|.| ||.       :.|:|..|...|....|..|:|.:.|:.|
  Fly   562 DRIKRVSKRRN-LEP-------KPLSIWRLSGIFVCCAGLYLVALIVFILE 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 17/80 (21%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 23/119 (19%)
Lig_chan 319..587 CDD:278489 58/311 (19%)
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 18/62 (29%)
Lig_chan 343..593 CDD:278489 58/310 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.