DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir52c

DIOPT Version :8

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_725470.1 Gene:Ir52c / 246630 FlyBaseID:FBgn0050468 Length:599 Species:Drosophila melanogaster

Alignment Length:675 Identity:130/676 (19%)
Similarity:249/676 (37%) Gaps:176/676 (26%)


  Fly     7 VFLLFML---DLKTLNLT---------RLNGLL----VEPTRD----------LPQL-------E 38
            :.:||.|   ..:.|::|         ||.|||    ||.:.|          :|.|       .
  Fly     5 IIILFCLGNSSSQILDVTNNSHLDFDYRLFGLLQRLQVEKSYDTLLVYGEDCAIPSLFERLQVPA 69

  Fly    39 LWLRAGSDHQDAENPYVQWFLLRTEIPLSIVTYQENRYWMDDPFGRRNLVLVMSLDQLLTNRGAA 103
            :.:.:||.:.|       |......:.|| ..:|:.|   ::.:  |.|:.:.:..:|:..:|..
  Fly    70 VLVSSGSTNFD-------WNFSSLTLILS-CNFQDER---EENY--RTLMKLQTSRRLILLKGHI 121

  Fly   104 APIQKASTFFYILADQDKDLSADE---QLRLEGSCRQLWTQHKVYNRFFLTRDGVWIYDPFKRRD 165
            .|  ::...||...:|.......|   ||.:..|||....|:  |.:..|. ||..||       
  Fly   122 KP--ESVCDFYSKKEQHNVAMVKENFYQLEVVYSCRLFQDQN--YEKLNLF-DGKSIY------- 174

  Fly   166 SAFGRLVRYYGSETLDKLLFRDMAGYPLR-IQMFRSVYTRPEFDKETGLLTRVTGVDFLVAQMLR 229
                            |..||:|.|.|:| :.......|.|..|.:||.......|..|::|.::
  Fly   175 ----------------KDQFRNMHGAPIRTLSDKEPPRTIPYIDSKTGEEKFKGYVGMLISQFVK 223

  Fly   230 ERLNFTMLLQQPEKKYFGERSANGSYNGAIGSIIKDGLDIC---LTGFFVKDYL---VQQYMDFT 288
             ::|.||.:::                    .:|||..::.   :|.|...|.|   :.:.....
  Fly   224 -KVNATMQIRE--------------------DLIKDDEEVSFVDITNFTSNDILDIGICEARTLE 267

  Fly   289 VAVYD--------DELCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALIWLTLR---VIN 342
            ::.||        ...|...|....:|.|.:.:..|...|.:.|::....|:::.:.::   ..:
  Fly   268 MSNYDAISYPYLMSSYCFMAPLPDSLPFSDVYMAIVAPSILIMFLIIFCICSVLIIYIQERSYRS 332

  Fly   343 LKLRIVSLGNQHIVGQALGIMVDTWVVWVRLNLSH---LPASYAERMFIGTLCLVSVIFGAIFES 404
            |.:|.|.:.:                :.:|..|:.   .|..|..::   .|..:.|.|.::..:
  Fly   333 LTIRSVLMND----------------ICLRGFLAQPFPFPRQYNRKL---KLIFMLVCFSSLIST 378

  Fly   405 SLATVYIH-----PLYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSPLFASLNKKLSWNRD 464
            ::.|.|:.     |.....:.:..::.:|      :| :||.:::..|   ...:||..|   .|
  Fly   379 TMYTAYLQAFLWGPPIEPRLTSFDDVKKS------RY-TMAINIYERE---FLEALNVSL---ED 430

  Fly   465 LRADVIDEVARFRNKAGVSRYTSLILESSHFTL-----LRKIWVVPECP-----KYYTISYVMPR 519
            :......:.::.|:... :.|...:.....||:     |.|..:...|.     ::..:|..:.|
  Fly   431 VEIYDYGKFSKLRSTFN-TNYLFPVTALQWFTINEEQKLFKYKIFYYCDAFCLNQFDILSIPLRR 494

  Fly   520 DSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVDIKMRSNILEADAESELVR--VLTIGDLQLAFY 582
            ..|:.|.....:|.....||...||  ::|:.|: :|:|:......|.|:.  .:.:.:|...|.
  Fly   495 HLPYRDIFEEHMLLQKEFGLTKYWI--DQSYRDM-IRANLTTFKDFSPLLENDYIEVHNLYWVFT 556

  Fly   583 VVIGGNLLAFLGFLAEHFR----WK 603
            :...|..:....|:.|..|    |:
  Fly   557 MYFVGMGMGLCFFILEILRPLRYWR 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 15/88 (17%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 16/102 (16%)
Lig_chan 319..587 CDD:278489 49/291 (17%)
Ir52cNP_725470.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.