DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir51b

DIOPT Version :8

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_725440.1 Gene:Ir51b / 246442 FlyBaseID:FBgn0050081 Length:597 Species:Drosophila melanogaster

Alignment Length:672 Identity:129/673 (19%)
Similarity:250/673 (37%) Gaps:165/673 (25%)


  Fly     7 VFLLFMLDLKTLNLTRLNGLL-VEPTRDLPQLELWLRAGSDHQDAE-NPYVQWFLLRTEIPLSIV 69
            |.||..|.....|:|.|..:| :..||: |.:...:..|.:.|..: |..:.| |.:|   :.:.
  Fly    10 VILLLALTNAAYNVTLLKSVLSLISTRE-PWINTPIFVGHNTQGGDLNDLIIW-LHQT---MGVT 69

  Fly    70 TYQENRYWMDD---PFGR----------------RNLVLVMSLDQLLTNRGAAAPIQKASTFFYI 115
            :...|.:...:   |.|.                ::.::.::||:.|..       .:......|
  Fly    70 SLTMNLFLQPEHIRPLGHFKITRYNGIALFFCHDKHDIMWLTLDRNLRK-------LRRIRLIII 127

  Fly   116 LADQDKDLSADEQLRLEGSCRQLWTQHKVYNRFFLTRDGVWIYDPFKRRDSAFGRLVRYYGSETL 180
            |.:|    .:..|..::.....|| |::..|...|.||.::.|.|:.        .:|::..:..
  Fly   128 LRNQ----RSGSQGAIKSIFNALW-QYQFLNVLVLQRDQLYSYTPYP--------AMRFFKLDIH 179

  Fly   181 DKLLF----RDMAGY----PLRIQMFRSVYTRPEFDKETGLLTRV--TGVDFLVAQMLRERLNFT 235
            .:.||    |:..||    |....:.|..:......|...:|...  |.|::|      :..|.:
  Fly   180 TEPLFPHAARNFHGYVVSTPAENDIPRVFHVHDPLTKSRKVLGYAYRTFVEYL------DHYNAS 238

  Fly   236 MLLQQPEKKYFGERSANGSYNGAIGSIIKDG-LDICLTGF-FVKDYLVQQYMDFTVAVYDDELCI 298
            :.|..|::......|.|.::   |..:|.|| |:|.|..: |......:.|   .:.:|.:  |:
  Fly   239 LRLTNPDENLDPTTSVNMNH---IVQLIIDGQLEISLHPYVFTPPTATKSY---PLLIYPN--CL 295

  Fly   299 YVPKASRIPQSI------------LPIFAVGYDIWLGFVLTAFACALIW---LTLRVINLKLRIV 348
            .||..:.||:.:            :.:|||.|...:.:.::.......|   |.|..::...:|:
  Fly   296 IVPMRNEIPRHMYLLRPFQLYSWYILLFAVFYITGILYCISPKLNKSSWPQRLGLNFLDAISKIL 360

  Fly   349 SLGNQHIVGQALGIMVDTW---VVWVRLN-LSHLPASYAERMFIGTLCLVSVIFGAIFESSLATV 409
                  .:...:.|...||   :::::|: |..:..|:               :....:|...|:
  Fly   361 ------FISPPITIYRPTWRHLIIFLQLSVLGFMSTSW---------------YNIELDSFFTTI 404

  Fly   410 YIHPLYYKDINTMQELDESGLKVVYK------YSSMADDLFFSETSPLFASLNKK------LSWN 462
            .:.    :.:|:|.:|.....:|:.|      :....:.....:.|.|...:|..      ||:|
  Fly   405 VVG----EQVNSMDQLVHQQQRVLVKEYEINTFLRHVEPRLVEKVSRLLVPVNASEQVSALLSFN 465

  Fly   463 RDLRADVIDEVARF----RNKA--GVSRYTSLILESSHFTLLRKIWVVPECPKYYTISYVMPRDS 521
            |.......:|..:|    :..|  .:.|::|..|.|.|                  |.|.|..||
  Fly   466 RSFAYPFTEERWQFFAMQQQYAFKPIFRFSSACLGSPH------------------IGYPMRVDS 512

  Fly   522 PWEDAVNALLLRFLNAGLIVKWI----QDEKSWVDIKMRSNILEADAESELVRVLTIGDLQLAFY 582
            ..|.::|..:|:..:.||:..|:    .|......::...|:|...:       :.:..|:|.:.
  Fly   513 HLETSLNHFILKIQDTGLLNHWVVSDFNDAMRAGYVRFVDNVLGYQS-------IDVDTLRLGWC 570

  Fly   583 VVIGGNLLAFLGFLAEHFRWKL 604
            |:..|.:|:.|.|..|:  |.|
  Fly   571 VLGIGWILSALVFSCEY--WHL 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 17/76 (22%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 15/103 (15%)
Lig_chan 319..587 CDD:278489 49/297 (16%)
Ir51bNP_725440.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.