DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8b5 and CG33298

Sequence 1:XP_006538058.1 Gene:Atp8b5 MGIID:2444287 Length:1195 Species:Mus musculus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1322 Identity:412/1323 (31%)
Similarity:642/1323 (49%) Gaps:281/1323 (21%)


Mouse    29 DRQKEEEERILQANN-------RRFNSLFEYPDNSIKTSKYGFFNFLPMNLFEQFQRLANAYFLI 86
            |:.:|...|.:..|:       :|.:...::..|.|:|:||...:|:|.||.|||.|:||.||:.
  Fly   220 DKFEERSYRTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIF 284

Mouse    87 LLFLQLVPQISSLAWYTTVIPLIVVLSITGVKDAIDDVVKWLPGLPSLDLKRHRSDQQINNRSVS 151
            ::.|..||:||:......:||::.||.:|.|||..:            |.:|..||::|||.:..
  Fly   285 IVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFE------------DRRRRASDKRINNTTCR 337

Mouse   152 ILVNG---RVEEIKWRNVQVGDIIKLENNHPVTADMLLLSSSEPYGLTYIETADLDGETNLKVKQ 213
            : .:|   |.:::||:.::||||:.|.||..|.||:|||.:|:|.|:.||:|.|||||||||.::
  Fly   338 V-YDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRRE 401

Mouse   214 AISVTSAMEDNLELLSSFNGEVRCDPPNNKLDKFSGTLSY-LGNTYLLNHERLLLRGCVIRNTDW 277
            .:.....|: ::.:.|.|...|..|.|..||.:|.|.|.: .|....::.|.||||...::|||:
  Fly   402 VVRGFEEMQ-SIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDY 465

Mouse   278 CYGLVVYTGQDTKLMQNSGRSTFKRTHIDHLMNVLVVWIFMFLGGMCFLLSIGHGIWENSRGYYF 342
            ..|:|||.|.:||.|.|:....:||:.::..||:.|:|..:.|..:|.:.:||..:|.:|..::.
  Fly   466 IEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFP 530

Mouse   343 QAFLPWKHYITSSATSSALIFWSYFIVLNTMVPISLYVSVEIIRLGNSYYINWDRKMFYAPKNMP 407
            ..:|| .:.:|:: ..|..|||:|.::|..|:|:||||::|:.::...::|:.:..:|.|..|..
  Fly   531 VPYLP-PNKLTAN-MESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQ 593

Mouse   408 AQARTTTLNEELGQVQYVFSDKTGTLTENVMIFNKCSINGKTYGYS-------YDDNGEYVPK-S 464
            .:.|...:.|||||:|::|:|||||||||.|||.:|.:||..|.:.       |...|...|. .
  Fly   594 TECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLI 658

Mouse   465 PKDKVDFSYNHLADPKFSFYDKTLVEAVKSEDPLVYLFFLCLSLCHTVM---------------- 513
            |.|.::.....|....:          :......:..|.:.|::|:||:                
  Fly   659 PNDNLNSDMAQLTQGTY----------LTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGII 713

Mouse   514 ----------------------------------------------------------------- 513
                                                                             
  Fly   714 EVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSP 778

Mouse   514 -----------------------------SEEK-------------------------------- 517
                                         ||.:                                
  Fly   779 PPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSI 843

Mouse   518 --------------------------VEGELVYQAQSPDEGALVTATRNFGFVFCSRTPETITV- 555
                                      .:|..:|:|:||||.|||.|..::.....:|:|..|.| 
  Fly   844 ATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVS 908

Mouse   556 IEM-GKIRVYRLLAILDFSNERKRMSVIVR-TPEDRVMLFCKGADTIIYELLHPSCAS------L 612
            :.| |..|.|.:|.:|.|.:.||.||::|| .....::|:.||||:.|..:|.| |:.      |
  Fly   909 MPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVP-CSHNSPEGIL 972

Mouse   613 SEVTMDHLDDFASEGLRTLMVAYRELDKAYFQTWIKKHGEAWLTLENRERKLALVYEEIERDLML 677
            .|.|...||.:|.||||.|::|.|.|:.|.:..|..:|.|..::||||||:|...:.::|.:|.|
  Fly   973 REQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTL 1037

Mouse   678 LGATAIEDKLQRGVPETIVTLSKAKIKIWVLTGDKQETAVNIAYSCRIFKDEMDGVFMVEGTDRE 742
            ||||.|||:||.||||||.:|..|.|.:|||||||.|||:|||||.::|..:|:.:.:       
  Fly  1038 LGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRL------- 1095

Mouse   743 TVLEELRTARKKMKPESLLESDPINMYLARKPKMPFKSLDEVANGNYG---------LVISGYSL 798
                   |||.:...|:     .||.||.     ..::....:...||         ||:.|.:|
  Fly  1096 -------TARSRDAAET-----AINFYLT-----DMENDKTTSTLGYGQSLRKKQRALVVDGKTL 1143

Mouse   799 AYALE--GSLEFELLRTACMCKGVVCCRMTPLQKAQVVDLVKRYKKVVTLAIGDGANDISMIKAA 861
            .:.|:  ..|....||.:..|..|:|||.||||||.:|.:||....:.||||||||||:|||:.|
  Fly  1144 TFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMA 1208

Mouse   862 HIGVGISNQEGMQATLSSDFSFCQFHFLQRLLLVHGRLSYNRMCKFLSYFFYKNFAFTLVHFWYA 926
            .:|||||.||||||.:::||:..:|.:|:||||.||...|:|:.:.:.||||||.||..:.|||.
  Fly  1209 DVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQ 1273

Mouse   927 FFNGFSAQTVYDIWFITFYNLIYTSLPVLGLSLFEKDVNETWSLCYPELYEPGQHNLYFNKKEFV 991
            .:.|||.|.:.|..::..||||:||||.|.:.:::|.|.|...|..|.||:.|:..:.:...:|.
  Fly  1274 LYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFW 1338

Mouse   992 KCLLHGIYNSFVLFFVPMGTVFNSERNDGKDISDFQSFSLLVQTTLIGVMTMQIALRTTSWTMIN 1056
            ..||..:|.|.|:|||.:.....|      |:..:: |...:..:.:....:..|:...|||:::
  Fly  1339 LILLDALYQSLVIFFVALCAYAES------DVGIWE-FGTTITASCLFANLVHCAIEIRSWTVLH 1396

Mouse  1057 HTFTWGSLGLYFCILILLCSDGLCLRYPSIFNFLGVARNS-------LSQPQIWLCLILSTILCM 1114
            ......|||.::  |..:..|.:|:      |..|| |:|       .:....||.::|||::.:
  Fly  1397 VLSIVLSLGSFY--LFAIVYDSVCM------NCFGV-RSSYWVIFVCFASAVHWLVIMLSTVVAV 1452

Mouse  1115 IPLIGYNFLRPLLWPINADKVL 1136
            :|.:....:|..|.|.::.||:
  Fly  1453 LPRLLLTTVRISLCPDDSTKVI 1474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8b5XP_006538058.1 PhoLip_ATPase_N 38..103 CDD:292826 24/72 (33%)
ATPase-Plipid 52..1135 CDD:273734 406/1290 (31%)
Cation_ATPase 508..603 CDD:289987 39/266 (15%)
HAD_like <845..866 CDD:304363 16/21 (76%)
PhoLip_ATPase_C 877..1129 CDD:292829 80/259 (31%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 22/50 (44%)
ATPase-Plipid 250..1473 CDD:273734 406/1290 (31%)
E1-E2_ATPase 302..>394 CDD:278548 42/105 (40%)
Cation_ATPase <880..965 CDD:289987 34/86 (40%)
HAD_like <1177..1240 CDD:304363 36/63 (57%)
PhoLip_ATPase_C 1223..1468 CDD:292829 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.