DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15199 and CG15202

DIOPT Version :8

Sequence 1:NP_001245617.1 Gene:CG15199 / 32051 FlyBaseID:FBgn0030270 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001245618.1 Gene:CG15202 / 32052 FlyBaseID:FBgn0030271 Length:115 Species:Drosophila melanogaster

Alignment Length:113 Identity:42/114 (37%)
Similarity:56/114 (49%) Gaps:14/114 (12%)


  Fly    10 AFVACLL-------AASVDGNGFSTQYRGHTQHPSLAEHCLYEELDLAVPLNGYVLPSGQQGYCI 67
            |.|||||       ||..|     ..|||:..||.....|.||||:.|:|......|..::|||.
  Fly     3 AGVACLLVLLGICGAARAD-----LTYRGNAVHPDYPGQCYYEELNQAIPKKQSYKPINREGYCQ 62

  Fly    68 RLECTDDYLLLIRHCDKQPW-PRPGCHLSPNDYDFKFPECCPQLECSD 114
            .:.|..||:|.|.:|.:... |...|.:: :|....||||||:|.|.:
  Fly    63 SIYCRPDYVLEISYCGRHNLVPTEKCRIA-SDMRRTFPECCPKLVCQE 109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15199NP_001245617.1 SVWC 53..112 CDD:292070 20/60 (33%)
CG15202NP_001245618.1 SVWC 37..107 CDD:292070 27/71 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131033509
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR39957
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.