DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and Mphosph9

DIOPT Version :8

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001264796.1 Gene:Mphosph9 / 269702 MGIID:2443138 Length:1144 Species:Mus musculus

Alignment Length:272 Identity:56/273 (21%)
Similarity:84/273 (31%) Gaps:83/273 (30%)


  Fly    27 QNFYNYQQQREQREQQPQIQISAIHHSRGSVGGGGGSNSSNAATDYS------------TSSGGK 79
            |..::.|.:|.|.|.:..:::...|.||.|......|...:|.|...            .||...
Mouse   109 QEQFHRQIRRIQEEIRKLVKLQLSHASRPSCSSSSVSEQVSAETQMGFFSENSERNESVVSSPAS 173

  Fly    80 RERDRSSAS---------DYSSSSS-----------------------------KQSSAAAANAA 106
            :|.:...||         |.||.||                             .|..|:...|.
Mouse   174 KEPETQPASSTSYPDCHVDSSSVSSGYGTFCILDMNTHKAKEPTEPLEPGAASQGQHPASVVQAH 238

  Fly   107 AAAAAVAALQYSPQFLQAQLALLQQQSNTTATPAAVAAAALSLANMCSSNGGQRNSGAGVSS--- 168
            ..|...||:.:..|..:...|.|::..:|  .|.......|....:.....|:.|||..|:|   
Mouse   239 GPAGGAAAINFFTQTPEELCASLKEDGST--FPGEFDRNFLGENKISEVYSGKANSGKSVTSWAQ 301

  Fly   169 -----------TSSGSNGQSMGLNLSSSQLKYPPPSTSPVVVTTQTSANITTPLTSTASLPSVGP 222
                       |....:|...|     |:|.:.||:.     |...:|:...|.....:.|:..|
Mouse   302 RLKQNQSKQAHTEDDCSGPKPG-----SELNWKPPAD-----TFDLAADAARPCAFYINKPAESP 356

  Fly   223 -------GNGLT 227
                   |.|||
Mouse   357 SSWLSDSGTGLT 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 56/273 (21%)
Mphosph9NP_001264796.1 Apolipoprotein 551..713 CDD:279749
Rootletin 580..744 CDD:291694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.