Sequence 1: | NP_001259439.1 | Gene: | CDK2AP1 / 32050 | FlyBaseID: | FBgn0030269 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001264796.1 | Gene: | Mphosph9 / 269702 | MGIID: | 2443138 | Length: | 1144 | Species: | Mus musculus |
Alignment Length: | 272 | Identity: | 56/272 - (20%) |
---|---|---|---|
Similarity: | 84/272 - (30%) | Gaps: | 83/272 - (30%) |
Fly 27 QNFYNYQQQREQREQQPQIQISAIHHSRGSVGGGGGSNSSNAATDYS------------TSSGGK 79
Fly 80 RERDRSSAS---------DYSSSSS-----------------------------KQSSAAAANAA 106
Fly 107 AAAAAVAALQYSPQFLQAQLALLQQQSNTTATPAAVAAAALSLANMCSSNGGQRNSGAGVSS--- 168
Fly 169 -----------TSSGSNGQSMGLNLSSSQLKYPPPSTSPVVVTTQTSANITTPLTSTASLPSVGP 222
Fly 223 -------GNGLT 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CDK2AP1 | NP_001259439.1 | CDK2AP | 1..280 | CDD:286844 | 56/272 (21%) |
Mphosph9 | NP_001264796.1 | Smc | <556..>759 | CDD:224117 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4713 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |