DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP1 and cdk2ap1

DIOPT Version :8

Sequence 1:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_017213656.1 Gene:cdk2ap1 / 108191561 ID: Length:87 Species:Danio rerio

Alignment Length:78 Identity:46/79 (58%)
Similarity:58/79 (73%) Gaps:7/79 (9%)


  Fly   210 PLTSTASLPSV----GPGNG---LTKYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARIL 267
            |:.:....||:    ||..|   .:|||:|||:|||:|::|||||.||:|:.|||||||:|||.|
Zfish     9 PILNDFGPPSLGFPQGPNGGQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGL 73

  Fly   268 VRECLMETERAAR 280
            |||||.||||.||
Zfish    74 VRECLAETERNAR 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 45/77 (58%)
cdk2ap1XP_017213656.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002597
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.