DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rpt3 and psmc1b

Sequence 1:NP_001285108.1 Gene:Rpt3 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001002091.1 Gene:psmc1b ZFINID:ZDB-GENE-040625-69 Length:440 Species:Danio rerio

Alignment Length:390 Identity:195/391 (50%)
Similarity:280/391 (72%) Gaps:17/391 (4%)


  Fly    18 LKLKDAHSSLDELDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPL 82
            |||.......|.|.||:.::|.::..|.||  |.|||               .:.:|..::..|:
Zfish    60 LKLLKQDRIKDYLLMEEEFIRNQEQMKPLE--EKQEE---------------ERSKVDDLRGTPM 107

  Fly    83 VIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSIS 147
            .:|...|.:|.|..||.::.||.:||.|||.:|::||:|..||.|:...:|::.||..:.|..::
Zfish   108 SVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVT 172

  Fly   148 MLQPDEKPDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAK 212
            :::.::.|..:||||||:|.|.|||:|:|||||||.|.|:::||.||:||::||.||.|||:|||
Zfish   173 VMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGAPGTGKTLLAK 237

  Fly   213 AVAHHTTASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGAD 277
            |||:.|:|:|:||||||.:|||||:||::||::||:|:|:||:|:||||||||.|||:|:.:|.:
Zfish   238 AVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGE 302

  Fly   278 REVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFST 342
            ||:||.:||||||:||||...:|||||||||.:||||||:||||:||||||||||.:.||.:|..
Zfish   303 REIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFQI 367

  Fly   343 ITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDEQ 407
            .||:|.::|||.|::.:...|.:|||||.|||.|||:.|:||.|..|..:||:|..:|.:.|.::
Zfish   368 HTSRMTVAEDVSLDDLILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQE 432

  Fly   408  407
            Zfish   433  432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 192/387 (50%)
AAA 197..330 CDD:278434 92/133 (69%)
psmc1bNP_001002091.1 PTZ00361 1..440 CDD:185575 195/391 (50%)
Prot_ATP_ID_OB 108..>176 CDD:293059 24/68 (35%)
AAA 222..355 CDD:278434 92/133 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.