DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rpt3 and rpt3

Sequence 1:NP_001285108.1 Gene:Rpt3 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_588437.1 Gene:rpt3 PomBaseID:SPCC576.10c Length:389 Species:Schizosaccharomyces pombe

Alignment Length:391 Identity:291/392 (74%)
Similarity:340/392 (87%) Gaps:5/392 (1%)


  Fly    25 SSLDELDMEDLYVRYKKLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLE 89
            :|.:|:   |||.|:|.|::.||.:::||.:||::.::||:|.:.||||||||||||||||||||
pombe     2 NSTEEI---DLYNRWKALERQLEMLDLQEGFIKEDCKSLKRELIRAQEEVKRIQSVPLVIGQFLE 63

  Fly    90 AVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPDEK 154
            |:||||.||||||||||.||||||:|||||||||||||.:|||||||:||||||||||||:|||:
pombe    64 AIDQNTAIVGSTTGSNYVVRILSTLDRELLKPSASVALQRHSNALVDILPPEADSSISMLRPDER 128

  Fly   155 PDVSYADIGGMDMQKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTT 219
            |||||||:||:|:||||:|||||||||..:||:|||||||||||:|||||.|||||.||||:.|.
pombe   129 PDVSYADVGGLDVQKQEVREAVELPLTQGDLYRQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTA 193

  Fly   220 ASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRIL 284
            |:||||||||||||||||||||||||||:|:||||||||||||||||||||||||||||||||||
pombe   194 ANFIRVVGSEFVQKYLGEGPRMVRDVFRMARENAPAIIFIDEIDAIATKRFDAQTGADREVQRIL 258

  Fly   285 LELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFP-LPDRRQKRLVFSTITSKMN 348
            :|||.|||||||..||||||||||||||||||||||||||||||| ..||||:||||.|||:||.
pombe   259 IELLTQMDGFDQGANVKVIMATNRADTLDPALLRPGRLDRKIEFPSYRDRRQRRLVFQTITAKML 323

  Fly   349 LSEDVDLEEFVARPDKISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKNNIK-KDEQEHEFY 412
            ||.:|||:.|:.|||..|||.|.||.|:||:.|||::|.::|..|.|:.|...:| .|.::..||
pombe   324 LSPEVDLDTFIMRPDASSGAQIAAIMQDAGLLAVRKSRGVILQSDIEEAYARAVKPTDMEQFAFY 388

  Fly   413 K 413
            |
pombe   389 K 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 290/390 (74%)
AAA 197..330 CDD:278434 120/134 (90%)
rpt3NP_588437.1 PTZ00454 2..389 CDD:240423 290/390 (74%)
P-loop_NTPase 99..>235 CDD:304359 114/136 (84%)
AAA 171..303 CDD:278434 119/132 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4744
Inparanoid 1 1.050 568 1.000 Inparanoid score I178
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003362
OrthoInspector 1 1.000 T631654
orthoMCL 1 0.900 OOG5_127831
Panther 1 1.100 LDO PTHR23073
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1000
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.