DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rpt3 and rpt-2

Sequence 1:NP_001285108.1 Gene:Rpt3 FlyBaseID:FBgn0028686 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_504558.1 Gene:rpt-2 WormBaseID:WBGene00004502 Length:443 Species:Caenorhabditis elegans

Alignment Length:377 Identity:189/378 (50%)
Similarity:283/378 (75%) Gaps:6/378 (2%)


  Fly    41 KLQKTLEFIEVQEEYIKDEQRNLKKEYLHAQEE---VKRIQSVPLVIGQFLEAVDQNTGIVGSTT 102
            |.::..:::.:::|:|::::| ||.:....:||   |..::..|:.:|...|.:|....||.:..
 Worm    67 KSERIKDYLLMEQEFIQNQER-LKPQEERQEEERAKVDELRGTPMAVGSLEEIIDDQHAIVSTNV 130

  Fly   103 GSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQPDEKPDVSYADIGGMDM 167
            ||.:||.|:|.:|:|.|:|..||.|:..::|::.||..:.|..:|:::.::.|..:|||:||:|.
 Worm   131 GSEHYVNIMSFVDKEQLEPGCSVLLNHKNHAVIGVLSDDTDPMVSVMKLEKAPQETYADVGGLDQ 195

  Fly   168 QKQEIREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTASFIRVVGSEFVQ 232
            |.|||:|||||||||.|.|:::||.||:||::||.||.|||:||||||:.|:|:|:|:||||.:|
 Worm   196 QIQEIKEAVELPLTHPEYYEEMGIRPPKGVILYGCPGTGKTLLAKAVANQTSATFLRIVGSELIQ 260

  Fly   233 KYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQT 297
            ||||:||:|||::||:|:||||:|:|||||||:.|||:|:.:|.:||:||.:||||||:||||..
 Worm   261 KYLGDGPKMVRELFRVAEENAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSR 325

  Fly   298 TNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITSKMNLSEDVDLEEFVARP 362
            .:|||:|||||.::|||||:||||:||||||||||.:.||.:|...||:|.|.::|:||||:...
 Worm   326 GDVKVLMATNRIESLDPALIRPGRIDRKIEFPLPDEKTKRRIFQIHTSRMTLGKEVNLEEFITAK 390

  Fly   363 DKISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKNNI--KKDEQEHEFY 412
            |::|||||.|:|.|||:.|:||.|..|..:||:|..:|.:  ||:....|.|
 Worm   391 DELSGADIKAMCTEAGLLALRERRMRVTMEDFQKSKENVLYRKKEGAPEELY 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpt3NP_001285108.1 PTZ00454 22..413 CDD:240423 189/378 (50%)
AAA 197..330 CDD:278434 90/133 (68%)
rpt-2NP_504558.1 PTZ00361 1..443 CDD:185575 189/378 (50%)
Prot_ATP_ID_OB 112..>179 CDD:293059 23/67 (34%)
AAA 225..358 CDD:278434 90/133 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.