DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1545 and CG1537

DIOPT Version :8

Sequence 1:NP_572677.2 Gene:CG1545 / 32036 FlyBaseID:FBgn0030259 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_572678.1 Gene:CG1537 / 32037 FlyBaseID:FBgn0030260 Length:135 Species:Drosophila melanogaster

Alignment Length:85 Identity:30/86 (35%)
Similarity:50/86 (58%) Gaps:12/86 (14%)


  Fly    43 DYNH--GSW-----ASQCWKKHNSGSIQ----TPDGEFKRPFGILCTYRCFLWFPPIYPYCEFIF 96
            |::|  ||.     .:.||::::..::|    ....:.|:|:||||.::|..:|...:|.||||:
  Fly    44 DFHHHGGSHHIRRNINHCWRRYDGYNLQNTVVNKKEQLKKPYGILCNFKCTWFFTVSFPTCEFIY 108

  Fly    97 DLRLS-RHFTSFPDCYEIRC 115
            |.:|| ..|||.|||..::|
  Fly   109 DYKLSCVLFTSLPDCTSVQC 128



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141177573
eggNOG 1 0.900 E1_2CCZH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.