DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and smyd4

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001070062.1 Gene:smyd4 ZFINID:ZDB-GENE-060929-248 Length:753 Species:Danio rerio

Alignment Length:546 Identity:102/547 (19%)
Similarity:175/547 (32%) Gaps:182/547 (33%)


  Fly    30 QEQQDKEQSPS-PTEEKELP---------------YRVEHSDIYGRYLVANRQLEAGETLIREE- 77
            |.|..|.:.|: |..:.:|.               ..|..|...||:::......|||.::.:| 
Zfish   153 QNQLRKAEKPNIPHTDHQLSPCQKTVNSTGHLSDGVSVYFSSDKGRHMLVMENKPAGEVVLEDEA 217

  Fly    78 ------PLAIGPCVSGDPV-CLG-----CYHPVSLKADQYRCPGCAWP-LCGSTCAGLKHRHGHT 129
                  |..|....:...| ..|     |:|.:|.......||.|::. .||.:|........| 
Zfish   218 YCSVLIPANIFNTGTNKAVETFGTEDRHCHHCLSQSLSFVPCPKCSYARYCGESCQKDAWDQWH- 281

  Fly   130 ETECQLYAERRA--VAGEL---LTERAGPAEVRDLYELVMIVR-----ILLLRQHDPEQ------ 178
            :.||.:.|:..|  |.|.|   :..:||..||:      |.::     :...:...|.|      
Zfish   282 QWECPVGADLLAIGVLGHLALRVVLKAGQTEVQ------MGIKNTKDHVTTYKNDSPVQLSLGGD 340

  Fly   179 -------------------FALIARMESHTEERR-----QNAVL------------WRHYEEKVV 207
                               ::|:..:..|:...|     ..||:            |..::::.|
Zfish   341 CGKSLDHTDCFHGSSYMGIYSLLPHVAQHSPASRFLMAITMAVIYGKLQGGPPPNKWMSFKDEGV 405

  Fly   208 QRLRVTWQLE--------------------DLEAEQVHEVCGILDVNCFEIGQNGAKARTLYPSA 252
               :.:||.|                    .:.|.:|.|..|:...:..||    ..|..::|..
Zfish   406 ---KASWQPEMSMLGATALRHMMQLRCNAQAITAVRVKEESGMAVQSSSEI----RIATAIFPVL 463

  Fly   253 FLLAHDCTPNTA--------------------HTDDP----SSFEILLRTSRRVREREALTLSYA 293
            .||.|.|:|||:                    |.|.|    |...:.:|.|:.:...:.:...|.
Zfish   464 SLLNHSCSPNTSISFTTGFQPDPHNQLGCSEGHFDHPKGSRSGVTVTVRASKDLTAGQEILHCYG 528

  Fly   294 --YTLQGTLKRRAFMHEGKLFWCCCRRC------SDPRELGTDCSALVCATCRTGSVRAVDPLQ- 349
              .:.....:|:..:.|...|.|.|:.|      ..|.........:.|..|.       .||| 
Zfish   529 PHRSRMEVKERQRLLLEQYFFQCVCQACQRDLSEGSPNAKEHTAPGMKCVKCG-------KPLQS 586

  Fly   350 QTGDWAC--DRCAHKMGATEVERQL----------------DRINNDLEDIDVHDIPGLENFLLR 396
            .|..:.|  ..|.|::.:.:|:.:|                ||:|..|..        |::...:
Zfish   587 HTDGYTCSWSSCGHQISSADVQNRLQGFQLLLDEAVHLMEQDRLNEALHI--------LQSAFSQ 643

  Fly   397 YRDVLRPNHYLLLSAKYSLCQIYGRT 422
            ...:|...|........:|.::|..|
Zfish   644 ANSILTETHPFQGELADALARLYAST 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
smyd4NP_001070062.1 TPR_11 68..134 CDD:290150
TPR repeat 68..96 CDD:276809
TPR repeat 101..134 CDD:276809
zf-MYND 246..285 CDD:280009 11/40 (28%)
SET <456..532 CDD:214614 16/76 (21%)
T6SS_VasJ <603..679 CDD:299836 12/76 (16%)
TPR_12 615..683 CDD:290160 10/64 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.