DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and SMYD3

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001161212.1 Gene:SMYD3 HGNCID:15513 Length:428 Species:Homo sapiens

Alignment Length:498 Identity:111/499 (22%)
Similarity:175/499 (35%) Gaps:147/499 (29%)


  Fly    58 GRYLVANRQLEAGETLIREEPLAIGPCV-SGDPVCLGCYHPVSLKADQYRCPGC----------- 110
            |..|.|...|..||.|.|.:|||...|. |...||..|   :..|....||..|           
Human    15 GNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRC---LLGKEKLMRCSQCRVAKYCSAKCQ 76

  Fly   111 --AWPLCGSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIVRILLLRQ 173
              |||.....|..||        .|:              .|..|..||.|..:|.  :::....
Human    77 KKAWPDHKRECKCLK--------SCK--------------PRYPPDSVRLLGRVVF--KLMDGAP 117

  Fly   174 HDPEQFALIARMESH----TEER----RQNAVLWRHYEEKVVQ---RLRVTWQLEDLEAEQVHEV 227
            .:.|:......:||:    ||::    ||..:.::|:..:.:|   :|...:.|.:..|:.:...
Human   118 SESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNS 182

  Fly   228 CGILDVNCFEIGQNGAKARTLYPSAFLLAHDCTPNTAHT-DDPSSFEILLRTSRRVREREALTLS 291
            ..|.:....|:|..      ||||..||.|.|.||.:.. :.|   .:|||..|.:...|.||:.
Human   183 FTICNAEMQEVGVG------LYPSISLLNHSCDPNCSIVFNGP---HLLLRAVRDIEVGEELTIC 238

  Fly   292 YAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVDPLQQTGD--- 353
            |...|..:.:||..:.:...|.|.|.||....:   |...|                  |||   
Human   239 YLDMLMTSEERRKQLRDQYCFECDCFRCQTQDK---DADML------------------TGDEQV 282

  Fly   354 WACDRCAHKMGATEVERQLDRINNDLEDIDVHDIPGLENFLLRYRDVLRPNHYLLLSAKYSLCQI 418
            |           .||:..|.:|    |::..|         .::..||            ::||.
Human   283 W-----------KEVQESLKKI----EELKAH---------WKWEQVL------------AMCQA 311

  Fly   419 YGRTEGYLLP-----QMSPEDIAR---------KES--YCREFLEIVDVLDPGLTRLRGL-IM-- 464
            ...:....||     |:...|.|.         :|:  |....:|...:..||...:||: :|  
Human   312 IISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKV 376

  Fly   465 --YELHAPVMVLAQS----AFQSGQISRQEFQRRLKEVVKLLQ 501
              .:||..:...|..    ||...:::.......:::::.||:
Human   377 GKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLE 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
SMYD3NP_001161212.1 S-adenosyl-L-methionine binding. {ECO:0000269|Ref.12} 14..16 1/1 (100%)
zf-MYND 49..87 CDD:280009 9/41 (22%)
SET <201..239 CDD:279228 14/41 (34%)
S-adenosyl-L-methionine binding. {ECO:0000269|Ref.12} 205..206 0/1 (0%)
C-terminal domain, essential for histone methyltransferase activity, nuclear localization and mediates interaction with HSP90AA1. {ECO:0000269|PubMed:25738358} 272..428 36/203 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.