DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and smyd3

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001032477.1 Gene:smyd3 ZFINID:ZDB-GENE-051120-138 Length:380 Species:Danio rerio

Alignment Length:404 Identity:103/405 (25%)
Similarity:139/405 (34%) Gaps:111/405 (27%)


  Fly    58 GRYLVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGC------------ 110
            |..|.|.|:::.||.:...||.|.  ||:.|.:...|...:.......||..|            
Zfish    15 GNGLRALREIKPGEVIYSCEPFAF--CVARDFLKTACQSCLKRGESLSRCSQCKTARYCNVQCQK 77

  Fly   111 -AWPLCGSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIVRILLLRQH 174
             |||.....|..|||......|:......|                        :|.::|...:.
Zfish    78 QAWPDHKRECKCLKHLQPRIPTDSVRLVAR------------------------IIFKLLSQSES 118

  Fly   175 DPEQFALIARMESHTEERRQNAVLWRHYEEKV--VQRLRVTWQLEDLEAEQVHEVCGI------L 231
            |.|:...||..:||..:..         |||.  ::.|..|     |:.....|.|.:      |
Zfish   119 DQEELYSIAEHQSHLADMS---------EEKTEGLKHLCTT-----LQVYLAEENCDLSRLPSGL 169

  Fly   232 D---------VNCFEI--GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPSSFE---ILLRTSRRV 282
            |         .|||.|  |:.......||||..||.|||.||..     ..||   :.||..|.:
Zfish   170 DPVSLLARVTCNCFSISDGELQDVGVGLYPSMSLLNHDCQPNCI-----MMFEGKRLTLRAVRVI 229

  Fly   283 REREALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVDP 347
            |..|.||:||...|..:..||: .|     |         .||..:..||:.........|.:..
Zfish   230 RSAEELTISYTDILAPSKDRRS-QH-----W---------DELLKESQALLHRHSDVVPDRNIYM 279

  Fly   348 LQQTGDWACDRCAHKMGATEVERQLDRINNDLEDI-----DVHDIPGLENFLLRYRDVLRPNHYL 407
            |:.. |.|.|.|   :...:.|..|:..|..|...     |.|....:|  |||   |.:..|:|
Zfish   280 LRLL-DLAMDAC---ISLDDYETALEYGNRALGPYKLYFSDPHPSRAVE--LLR---VGKLQHFL 335

  Fly   408 --LLSAKYSLCQIY 419
              |..|:.|..|.|
Zfish   336 GRLEEARGSFTQAY 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
smyd3NP_001032477.1 zf-MYND 49..87 CDD:280009 7/38 (18%)
SET <201..239 CDD:279228 17/43 (40%)
TPR_12 276..351 CDD:290160 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.