DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and smyd5

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001107677.1 Gene:smyd5 XenbaseID:XB-GENE-988091 Length:421 Species:Xenopus tropicalis

Alignment Length:380 Identity:77/381 (20%)
Similarity:119/381 (31%) Gaps:137/381 (36%)


  Fly    58 GRYLVANRQLEAGETLIREEPL--------------AIGPC-------------VSGDPVCLGCY 95
            |:.|.|.|.:..|||:.:|:||              |...|             :||:...:..|
 Frog    32 GKGLFATRAIRKGETIFQEKPLVSSQFQWNALYRYRACDHCLRSLETAEENAQRLSGNAHVVLPY 96

  Fly    96 HPVSLKAD--QYRCPGCAWPLCGSTC--AGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEV 156
            ..:....:  ..:||.|....|.:.|  |.....|             ||:.  |...|..||  
 Frog    97 PELCTVRNGLHQQCPRCQVTYCSAECLKAAADQYH-------------RALC--LGASRDNPA-- 144

  Fly   157 RDLYELVMIVRILLLRQHDPEQFA---LIARMESHTEE-RRQNAVLWRHY-----------EEKV 206
            ..|.:|....|    ..|.|.:.|   |:|||....:: :.|:...|.|.           ||::
 Frog   145 HPLNKLEEAWR----NMHYPPETASIMLMARMVGTIKQVQAQDKDWWMHLFSQFCNKTANEEEEI 205

  Fly   207 VQRL---RVTWQLEDLE----------------------------------------AEQVHEVC 228
            |.:|   :...||:.|.                                        ::.|| .|
 Frog   206 VHKLLGDKFKGQLDQLRRLFTDALYEERVSRWFTPEGFRSLFALVGTNGQGIGTSSLSQWVH-AC 269

  Fly   229 GILDVNCFEIGQNGAKARTLY---------------PSAFLLA----HDCTPNTAHTDDPSSFEI 274
            ..|::...|..|..:....||               ...:||.    |.|.||...:...::|.:
 Frog   270 DALELPPREREQLDSLIDQLYKDIEKVTGEFLNCEGSGLYLLQSCCNHSCVPNAEASFPDNNFIL 334

  Fly   275 LLRTSRRVREREALTLSYAYTLQ---GTLKRRAFMHEGKLFWCCCRRC----SDP 322
            .|.....::..|.:.:||....|   ....|:..:.|..||.|.|.:|    .||
 Frog   335 HLTALEDIQPGEEICISYLDCCQRDRSRHSRQKILRENYLFVCSCPKCLAQADDP 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
smyd5NP_001107677.1 SET 22..>71 CDD:295368 11/39 (28%)
zf-MYND 100..135 CDD:280009 9/48 (19%)
SET <277..352 CDD:214614 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.