DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and Smyd3

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster

Alignment Length:489 Identity:102/490 (21%)
Similarity:176/490 (36%) Gaps:128/490 (26%)


  Fly    66 QLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYR---------------CPGCAW-PL 114
            |::.|:.::.|:|.|.                 .||: |||               |..|.: ..
  Fly    34 QIKRGQRILTEKPFAF-----------------VLKS-QYRLERCDNCLEATKVLKCSNCRYVSY 80

  Fly   115 CGSTC---AGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIVRILLLRQHDP 176
            |..:|   |..:|:|     ||.            ..::..|..|.|...  |:.|::|..:|..
  Fly    81 CHRSCQMQAWGQHKH-----ECP------------FLKKVHPRVVPDAAR--MLCRLILRLEHGG 126

  Fly   177 EQFALIARMESHTEE-RRQNAVLWRHYEEKVVQRLRVTW------QLEDLEAE---------QVH 225
            :   ||...  :||. .|:...|..||.|.....:|:..      .|.|:.||         ::.
  Fly   127 D---LIRGY--YTEHGSRKFRDLMSHYAEIKNDPMRLEHLDSLHAVLTDMMAESPSTVPNKTELM 186

  Fly   226 EVCGILDVNCFEI--GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPSSFEILLRTSRRVREREAL 288
            .:.|.|..|.|.|  .:..:.|..:|....:..|.|.||...|.:.:...:     ..:.:.|.|
  Fly   187 SIYGRLITNGFNILDAEMNSIATAIYLGVSITDHSCQPNAVATFEGNELHV-----HAIEDMECL 246

  Fly   289 T-----LSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVDPL 348
            .     :||...|....:||..:.|...|.|.|.:|:|.:| ..:..|.:|.....|:..:||..
  Fly   247 DWSKIFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAKE-SKEMLAALCPNRNCGAGISVDRN 310

  Fly   349 QQTGDWACDRCAHKMGATEVERQLDRINNDLEDIDVHDIPGLENFLLRYRDVLRPNHYLLLSAKY 413
            .      |.||     ...:..:|....|:...:..|::..:::  :.|.||             
  Fly   311 N------CPRC-----DAGISPKLRNAFNEAMTLTRHNLENMKD--VAYLDV------------- 349

  Fly   414 SLCQI-YGRTEGYLLPQMSPEDIARKESYCREFLEI---VDVLDPGLTRLRGLIMYELHAP-VMV 473
              |:: ..:..|...| ::...:...::.....:|:   .|.||.|...|.|...|  |.| ..:
  Fly   350 --CKVCLDKQTGVFHP-LNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPGFRKY--HGPWNPL 409

  Fly   474 LAQSAFQSGQISRQEFQRRLKEVVKLLQVSRDIL 507
            |.....:.|:|  |.::...||.:..|:.::.||
  Fly   410 LGLLHMKLGKI--QLYEGHSKEALHHLEEAQRIL 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 8/42 (19%)
TPR_12 377..440 CDD:290160 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.