DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and Smyd4-1

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster

Alignment Length:416 Identity:82/417 (20%)
Similarity:134/417 (32%) Gaps:151/417 (36%)


  Fly    22 GGQQSKDKQEQQ--DKEQS----PSPTEEKELPYRVEHSDI---------YGRYLVANRQLEAGE 71
            |..|.|:..|||  |.:|.    .:...|:|...:|....:         .|||:||...:..|.
  Fly   175 GQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGPRGRYMVAKEAISKGN 239

  Fly    72 TLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGCAWPL--CGSTCAGLKHRHGHT---ET 131
            .:..|......| :....:|..|  ..:|.:....||.|...:  |...|     |..|:   :.
  Fly   240 VIFSERASCFVP-LEQLLICQQC--AATLMSAPIPCPNCHQRVVYCSRKC-----REAHSAIHKF 296

  Fly   132 ECQLYAERRAVAGELLTERAGPAEVRDLYELV----MIVRILL-----LRQHDPEQFALIARME- 186
            ||..|.                   :|:..|:    :.:|:||     :|.|..|..:.....| 
  Fly   297 ECAAYR-------------------KDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEE 342

  Fly   187 ----SHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDLEAEQV--HEVCGIL-------------- 231
                |...|..:||       .:.::.||:..||:....|::  |.:|..|              
  Fly   343 IMNLSRKPEESENA-------PEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQ 400

  Fly   232 ------DVNCFEI----------GQ---NGAKARTLY-----PSAFL------------------ 254
                  .:..:::          ||   ||.....|.     |..|:                  
  Fly   401 FHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQL 465

  Fly   255 --LAHDCTPNTA----------HTDDPS---SFE---ILLRTSRRVREREALTLSYAYTLQGTLK 301
              |:|. .|.||          |..:||   .|:   ::...::.:.|.|.:...|....:.:||
  Fly   466 HNLSHS-DPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLK 529

  Fly   302 RRAFMHEGKL---FWCCCRRC--SDP 322
            .:. .|..|.   |.|.|.:|  :||
  Fly   530 LQR-SHPLKAIYKFECTCAKCTRTDP 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/47 (23%)
SET <447..526 CDD:214614 12/80 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.