DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and SmydA-3

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001260366.1 Gene:SmydA-3 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster

Alignment Length:491 Identity:163/492 (33%)
Similarity:256/492 (52%) Gaps:20/492 (4%)


  Fly    51 VEHSDIYGRYLVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGCAWPLC 115
            |:.|.:.||||||...:.....||.|.|.|:||..:|..||||||.| :...::..|..|.||||
  Fly    14 VQWSPVCGRYLVAKGAIRGHGLLIEELPFAVGPKCNGPVVCLGCYEP-NPDPEEELCSECGWPLC 77

  Fly   116 GSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYEL--VMIVRILLLRQHDPEQ 178
             ..|| .:..:.|...||....:.||....|      |:..|...:|  :|.:|:||.::.:||:
  Fly    78 -VECA-QQADNAHFRLECSQLKDARARFFRL------PSGSRHCPQLDCIMPLRVLLAKEANPER 134

  Fly   179 F-ALIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDLEAEQ-VHEVCGILDVNCFEI-GQ 240
            : ..:|.||.|.|||:::|.:|......:.|.||...||.:..:|: :.:|.|:|:||.||. ..
  Fly   135 WDNEVAPMEHHKEERQRDADVWHADRVNIAQYLRGPCQLANRFSEELIMQVVGVLEVNAFEARSP 199

  Fly   241 NGAKARTLYPSAFLLAHDCTPNTAHTDDPS-SFEILLRTSRRVREREALTLSYAYTLQGTLKRRA 304
            .|...|.|:|...:|||:|.|||:.:..|| .::|.||....:.|.:.|..||.|||.||.:|:.
  Fly   200 KGYPLRCLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSYTYTLDGTAQRQK 264

  Fly   305 FMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVDPLQQTGDWACDRCAHKMGATEVE 369
            .:.:||.|.|.|.||.||.||||..|:|.|..|..|......|.:....|.|..|.......:..
  Fly   265 HLKQGKFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPRQPTEPDTSWNCANCGSDTSNADAL 329

  Fly   370 RQLDRINNDLEDID-----VHDIPGLENFLLRYRDVLRPNHYLLLSAKYSLCQIYGRTEGYLLPQ 429
            ..|..:.:::..:.     ...:..:|..|.:|:.:|.|.|::....:..|.::|||.:||.:.|
  Fly   330 AMLQSLQSEVNAVQALPMAAKRLEEIERLLRKYKSLLHPLHFIATGLRQLLIEMYGRVQGYEMVQ 394

  Fly   430 MSPEDIARKESYCREFLEIVDVLDPGLTRLRGLIMYELHAPVMVLAQSAFQSGQISRQEFQRRLK 494
            :....:.||...||:.|.:::..:|||:|.|.:.:||||.|:::||:|.|.:|::...|.:.||.
  Fly   395 LPDHQLERKAELCRQVLRVLNTFEPGLSRTRAMNLYELHVPLVLLAKSGFIAGKLKGGELRARLV 459

  Fly   495 EVVKLLQVSRDILLMEPEGSTENAMGQAAADALSKM 530
            :.:.||:...:||..|.:.|.|..:...|..||.::
  Fly   460 DAIDLLKECVEILEFEDKSSQEGVLCVVAKQALKQL 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1845
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.