DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and SmydA-9

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001285040.1 Gene:SmydA-9 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster

Alignment Length:521 Identity:131/522 (25%)
Similarity:224/522 (43%) Gaps:82/522 (16%)


  Fly    40 SPTEEKELPYRVEHSDIYGRYLVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKAD- 103
            :|.::|:..:.:..|.|.||.:||.|.|:.||.:.|:.||.||.....:.....|...:.:..| 
  Fly    16 APFKDKDPAWEIGVSKIAGRGVVATRSLKRGEIIFRDSPLLIGLAAHEEDSLNACSVCLKMLPDT 80

  Fly   104 QYRC-PGCAWPLCGSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIVR 167
            ::.| .||..|:| |.|| .|.:|   :::|.|:            :..||.| .|:...| |:|
  Fly    81 RFMCRQGCGLPVC-SLCA-KKKQH---KSDCDLF------------KSWGPNE-PDVANSV-IIR 126

  Fly   168 ILLLRQH---DPEQ----FALIARME-SHTEERRQNAVLWRHY--EEKVVQRLRVTWQLEDLEAE 222
            :|.:.:.   ..||    :.|.|.:: :|..|.|..|..::::  ::|::              |
  Fly   127 LLCVARAINLSKEQRDLIYCLQANLDNNHRTEVRNAAKCFKNFPTDKKLI--------------E 177

  Fly   223 QVHEVCGILDVNCFEIGQNGA------KARTLYPSAFLLAHDCTPNTAHTDDPSSFEILLRTSRR 281
            .::....:|..|.|:...:..      ..|.|||...::.|||.||..:|.:..:..:::|.:..
  Fly   178 IMNRTVAVLRTNGFDKTTDRTNDNQEFNYRALYPLFGVVNHDCIPNAYYTFEEKTNNMIVRAAVD 242

  Fly   282 VREREALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVD 346
            :.|...:|.:|.....|.:.|..|:...|.|.|.|.|||||.|.|...|.|.|..  |.....|.
  Fly   243 IPEGFEVTTTYTKLFTGNIARHLFLKMKKSFTCKCSRCSDPTEKGAFISGLYCRD--TNCTGLVV 305

  Fly   347 PLQQTG----DWACDRCAHKMGATEVERQLDRINNDLE-DIDVHDIPGLENFLLRYRDVLRP-NH 405
            | :.||    :|.|..|..|....::.:..|..:..:. .::.:.:..|..:|....|...| ::
  Fly   306 P-EITGLPHPNWNCLVCKQKSTHAQMMKSQDFASGAINAKVNSNSLRTLVQYLNEKSDSFIPSSN 369

  Fly   406 YLLLSAKYSLCQ--IYGRTEGYLLPQMSPEDIAR--KESYCREFLEIVDVLDPG----LTRLRGL 462
            |:::.||.|:.|  ..||.:       ..|::|.  :..|.|:..:::|.|..|    .|.|..|
  Fly   370 YVVIDAKMSVLQRLQQGRED-------CSEELAHNTRLRYSRDITQLMDKLGLGDSLLRTHLEEL 427

  Fly   463 IMYELHAPVMVLAQSAFQSGQISRQEFQRRLKEVVKLLQV-----SRDILLMEPEGSTENAMGQA 522
            :..|.......||..|.:..:::  |.|.:..|..|||:|     |......||.|:.:.....|
  Fly   428 LRREEERRAKRLADEAEKQRKLA--ELQAKAAEADKLLEVLQKEQSEQSEQAEPAGTADPGTAPA 490

  Fly   523 A 523
            |
  Fly   491 A 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
SmydA-9NP_001285040.1 SET 25..>66 CDD:295368 15/41 (37%)
SET <216..253 CDD:279228 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.