DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-4 and set-3

Sequence 1:NP_572675.1 Gene:SmydA-4 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_499143.1 Gene:set-3 WormBaseID:WBGene00007403 Length:465 Species:Caenorhabditis elegans

Alignment Length:186 Identity:44/187 (24%)
Similarity:68/187 (36%) Gaps:51/187 (27%)


  Fly   194 QNAVLWRHYEEKVVQRLRV--TW-QLEDL----------------EAEQVHEVCGILDVNCFEIG 239
            |||:      :::|:.|..  .| :|:.:                .|:..|.:..|..:...|  
 Worm   158 QNAI------KRIVESLETDENWGRLDQISRTMTFTKALRIMAERSAKNAHTIYSIEQIESQE-- 214

  Fly   240 QNGAKARTLYPSAFLLAHDCTPNTAHTDDPSSFEI---LLRTSRRVREREALTLSYAYTL-QGTL 300
            .|...|..|:|.:.:..|.||||.      |.|.:   .:..|:.||.||.|..||..|. |.|.
 Worm   215 DNLPMATGLFPISSIFNHSCTPNI------SGFFVRNTFIFVSQGVRAREELLDSYGVTYHQHTF 273

  Fly   301 KRRA-FMHEGKLFWCCCRRC-------------SDPRELGTDCSALVCATCRTGSV 342
            ::|. |:.....|.|.|..|             ..|..:.|:.|.....|..|.::
 Worm   274 EQRTNFLASVSGFICHCESCFKMKSLKVLEKPKKYPETIATNASCFTDITSYTENI 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-4NP_572675.1 None
set-3NP_499143.1 SET <220..271 CDD:214614 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.