DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C901 and C02B10.3

DIOPT Version :10

Sequence 1:NP_572673.1 Gene:C901 / 32032 FlyBaseID:FBgn0021742 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_500723.1 Gene:C02B10.3 / 177284 WormBaseID:WBGene00015328 Length:247 Species:Caenorhabditis elegans


Alignment Length:170 Identity:48/170 - (28%)
Similarity:61/170 - (35%) Gaps:49/170 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GECRCRIGYSGELCDK--------------CIPLPGCQHGGC----TKPFECICKPGWAGLFCTE 145
            |:|.|.|.:.|.:|::              |.| ..|||.|.    .|..||||.|.|.|.||..
 Worm    88 GKCTCNINWKGPICNEYDGCGKGETLFGTSCTP-HMCQHNGTIAVGKKEIECICPPPWDGRFCER 151

  Fly   146 PSCRTGCHSTR--GYCEAPGECRCRIGYAGRTCSECATMPGCQHGTCNKPL---ECLCLPGYTGL 205
            .:|.....||:  .|......|.|...|:|.:|.   .:..|.:   |..|   :|.|..||.| 
 Worm   152 LACWRKTISTQQHRYRNNGDHCICGNHYSGASCD---VIKSCLN---NGQLIDGKCKCPDGYYG- 209

  Fly   206 LCQTPICDPDCSKQHGYCRKPGECRCKVGWTGSQCDKCFP 245
                .:||..|.|.|..|              |.|....|
 Worm   210 ----DLCDKRCQKGHVTC--------------STCSSFIP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C901NP_572673.1 DSL <56..82 CDD:473190
EGF_CA 280..315 CDD:238011
C02B10.3NP_500723.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.