DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXA6 and unpg

Sequence 1:NP_076919.1 Gene:HOXA6 HGNCID:5107 Length:233 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:131 Identity:46/132 (35%)
Similarity:65/132 (49%) Gaps:2/132 (2%)


Human    82 DKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSC 146
            |.:.||.|.|.......|.:|.....:.:....::|.......||||..::............: 
  Fly   248 DFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGN- 311

Human   147 AGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWK 211
             |:...|..||.|..:|..|.||||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||
  Fly   312 -GSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK 375

Human   212 K 212
            :
  Fly   376 R 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXA6NP_076919.1 Antp-type hexapeptide 136..141 0/5 (0%)
Homeobox 159..211 CDD:306543 29/52 (56%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.