DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myo10A and ck

Sequence 1:NP_001036269.2 Gene:Myo10A FlyBaseID:FBgn0263705 Length:3145 Species:Drosophila melanogaster
Sequence 2:NP_001285949.1 Gene:ck FlyBaseID:FBgn0000317 Length:2167 Species:Drosophila melanogaster

Alignment Length:3130 Identity:715/3131 (23%)
Similarity:1112/3131 (36%) Gaps:1144/3131 (37%)


  Fly   143 EGSLRARQDLGSSGVEDMTLLDDLHEASLLWNLRLRYDKGLIYTFAGSILIAVNPYKMFPDAYGL 207
            |..::|.......|||||..|.|||||.:|.||.:||.:.||||:.||||:|||||::.|...|.
  Fly    51 ERRIKAMHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGD 115

  Fly   208 EVAKQYAGRPLGSLPPHLFAIGAAAHAALP---SPQVVVISGESGSGKTESTKLVMQYLAAVVPG 269
            :: |.|..|.:|.||||:||||..|:|.:.   ..|.:|||||||:||||||||::|||||:   
  Fly   116 QI-KLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAI--- 176

  Fly   270 GGSASAVITEQILEAAPLLEAFGNARTARNDNSSRFGKYLEVYFK-SGAIVGAKITQYLLEKSRI 333
             ....:.|.:|||||.|:|||||||:|.|||||||||||::::|. :|.|.||||.|||||||||
  Fly   177 -SGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRI 240

  Fly   334 VTQAPGERNYHVFYELLGGLSETERSKYGLLEADKYFYLNQGATDCASGRVD---WESLQGAMQV 395
            |:|...||||||||.:|.|||..|:|:..|..|..|.||..|.:....||.|   :..::.||:|
  Fly   241 VSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKV 305

  Fly   396 LGVSEGEREGIVRVLAAVLHLGNVYFHRRQLRHGQEGVEVGSDAEIKWAAHLLHISADGLHRALT 460
            |..|:.|...|:::|||:||.||:.: :..:....:..|:.....::..|.||.:....|..|||
  Fly   306 LLFSDQEIWEIIKLLAALLHCGNIKY-KATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALT 369

  Fly   461 SRTTEARAERLHTPLGIDQALDARDAFAKALYAGLFNWLVSRINSIVQKGGTHDAHRISILDIFG 525
            .||..|..|.:.:.|..||::|.||||.|.:|..:|..:|.:||:.:.|......:.|.:|||||
  Fly   370 RRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIFKPRGTSRNAIGVLDIFG 434

  Fly   526 FEDLAENSFEQLCINYANENLQLYFNKHVFKLEQAEYARERLEWTPLAWDDNLPVIHLLAKKPVG 590
            ||:..:|||||.||||||||||.:|.:|:|||||.||..|.:.|..:.:.||...:.|:|.|.:.
  Fly   435 FENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLN 499

  Fly   591 ICHLLDDESNFPRATDLSFLEKCHYNHALSELYARPRIGAQ-EFGVTHYAGQVWYCVDGFLDKNR 654
            |..|:|:|:.||:.||.:.|.|.|..|...:.|.:|:.... .||:.|:||.|:|...|||||||
  Fly   500 IMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNR 564

  Fly   655 DALRGDVLELLASSRLPLVGELTKQLRAQRDAGKTLPKGSNGRFVTMKPRTPTVAARFADSLQQL 719
            |....|:|.|::.|    ..:..:|:.||     .:..|:..|     .||||::.:|..||..|
  Fly   565 DTFSPDLLHLVSQS----TNKFLRQIFAQ-----DIEMGAETR-----KRTPTLSTQFRKSLDAL 615

  Fly   720 LQSMGRCHPWFVRCIKPNQEKHALRMDMPCVLQQLRYLGMLDTIQIRQRGYPVRLRFQHFVERYR 784
            ::::..|.|:|:||||||:.|..:..|.....:||||.||::||:||:.|||:|..|:.||||||
  Fly   616 MKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYR 680

  Fly   785 HLLPSPLARGTP--YRELCRALLEAMPRTGVEGPDYQLGATRVFLREALHRALESGRTERLRRAA 847
            .|:|     |.|  :|..|:|....:....:...|||||.|:|||::|....||..|...|.|..
  Fly   681 FLIP-----GVPPAHRTDCQAATSRICAVVLGKSDYQLGHTKVFLKDAHDLFLEQERDRVLTRKI 740

  Fly   848 VSVQRHVRGMLVRRQLARRQAAATRLQARWRGQRAQQRYERLRKGALTAQRLWRGRQARRRVQQL 912
            :.:||.:||.:.||:..|.:|||..:|..|:|...::||..:|.|.:..|.|.|.|....|.:.|
  Fly   741 LILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHL 805

  Fly   913 RSD------HRRRQEAREAAQRAREAREAKQAVLERSQLSYLDIPAELAFIYSKLQGWSPPHGDR 971
            |..      |.|....|      ||......||:                   |:|.        
  Fly   806 RGHIVGLQAHARGYLVR------REYGHKMWAVI-------------------KIQS-------- 837

  Fly   972 HLVKVLGTVPGPPSSAVQLPEDLGQFSFGKFSSVYCNGLRLQPRREPITAPLLTRAASRDQDFQD 1036
            |:.:::                    :..::..     |||:.::                 |.:
  Fly   838 HVRRMI--------------------AMRRYRK-----LRLEHKQ-----------------FAE 860

  Fly  1037 ALAVFKLILRWSNDKALEGAKEKLLADYIVHKALSSRGLRDEILVQLCNQVHGLPPNSGEATRLW 1101
            .|.:.||            .:::||          .||                           
  Fly   861 VLQLRKL------------EEQELL----------HRG--------------------------- 876

  Fly  1102 QLLGQCLCCFQPSAAFSKYLMRFVDDEAPESLRPLLLRQLLRQQGGGTSSGAVGAGACRSFVPAW 1166
                            :|:.....:....:.|..|..|::..|                      
  Fly   877 ----------------NKHAREIAEQHYRDRLHELERREIQEQ---------------------- 903

  Fly  1167 LEWRAWTRGCDMALPLTLPDEASQTVAVDSWTSCEEAAALAVSSLGVASRGWTLVLDDGQQLTDS 1231
            ||.|...             |.:..:..|:....||.                  :|||:     
  Fly   904 LENRRRV-------------EVNMNIINDAARKQEEP------------------VDDGK----- 932

  Fly  1232 CGLDYVMDLIAEKELCPAFPAPRSDLLRSGAKFARTTLPDAVKRPAVPPPAPPTSSGKEDVPRER 1296
                                     |:.:...|    |||:      ...||....|:|      
  Fly   933 -------------------------LVEAMFDF----LPDS------SSDAPTPHGGRE------ 956

  Fly  1297 RSSRELLSRSSALNERYFEREPSPGPGQGSSTGQAKSRSKSLDDLLAGDIVPVPTDCDSQEPLHT 1361
                     :|..|:                  ...:::.:.||::|              |:| 
  Fly   957 ---------TSVFND------------------LPHAQNVNQDDIIA--------------PIH- 979

  Fly  1362 LGLSESRLNDRYHSAERLAPVGKDTGPRYQKSQHAGRRSHAASH--GSHSSKYADKAEYATRSSA 1424
              :||..        |.|:..      ::||        .||::  |:.:.:||.||        
  Fly   980 --ISEDE--------EDLSEF------KFQK--------FAATYFQGNVNHQYAKKA-------- 1012

  Fly  1425 MSDTSEAPSLASHVRRVRVPSQA--SDVDQFLDDLFSP---VLDGSLDELSDARSLAASIRGGSY 1484
                .:.|.|..|.:..::.:||  ..:.:|..|:..|   .:| .:|..|....:.|::.....
  Fly  1013 ----LKHPLLPLHTQGDQLAAQALWITILRFTGDMPEPKYHTMD-RMDTTSVMSKVTATLGRNFI 1072

  Fly  1485 EQENEAESEIDDLDDYINDIF---QPIPLVQNLEKLT--SKDQLAAIIKGGGVASKPEERDEESE 1544
            ..:...|:::..||.   |.|   :|..:...|..||  .|::|.              .|....
  Fly  1073 RSKEFQEAQLMGLDP---DAFLKQKPRSIRHKLVSLTLKRKNKLG--------------EDVRRR 1120

  Fly  1545 IEDLDDYINELFEPIPVAEGLDKLTSKEHLAVSIRGGGSTDSNGADPLLHQLMQLPGETESGPAL 1609
            ::| |:|                               :.||                       
  Fly  1121 LQD-DEY-------------------------------TADS----------------------- 1130

  Fly  1610 YQQQVQRAFLQSAMAQNLQIQQQLLAQNQALQTLLSQQAAAAAANNSTSPPPAPPILSSLSISPP 1674
            ||     ::|||....||: :...:..:..|:..|..:.........|:.|              
  Fly  1131 YQ-----SWLQSRPTSNLE-KLHFIIGHGILRAELRDEIYCQICKQLTNNP-------------- 1175

  Fly  1675 PPQSPMRMKATRSSLVVMESLQPPPPPPPPPMPPPLECKDPSETRHFLDPYGRAKTVRIGKWRWP 1739
                   :|::.:...::.||             .:.|..|||  .|:: |.|| .:|.|     
  Fly  1176 -------LKSSHARGWILLSL-------------CVGCFAPSE--KFVN-YLRA-FIREG----- 1211

  Fly  1740 PPQDEPQFQTEEDFFAFKMRQHQRKTTPQAQHHQMTSNGGMMESGPGARGASATAIEWEEFEIES 1804
            ||...|..:                     :..:.|.|.|.....|          .|.|.:...
  Fly  1212 PPGYAPYCE---------------------ERLKRTFNNGTRNQPP----------SWLELQATK 1245

  Fly  1805 PTPPPMSGQLMRSSIRLETTTTTTTSAVNNRDRDRETQDVGQPMQSVVTTKLAKKSFEIGADRPP 1869
            ...|.|   |..:.:...|.|....||...|:...:..|                          
  Fly  1246 SKKPIM---LPITFMDGNTKTLLADSATTARELCNQLSD-------------------------- 1281

  Fly  1870 PGSVGKLKLSSEMRQRLEQVTAGHSVRSTVSTKSEQRAPAKLEDTRKLMLQQQLG-----GLFAS 1929
                                                          |:.|:.|.|     .||..
  Fly  1282 ----------------------------------------------KISLKDQFGFSLYIALFDK 1300

  Fly  1930 VSGGNSGPGGVVDSHATVRTQIERMEGKLSPPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAP 1994
            ||...||...|:|                                                    
  Fly  1301 VSSLGSGGDHVMD---------------------------------------------------- 1313

  Fly  1995 PAPPPAPQSPPTARSPEPEPDYRTSSSQVVKEHVPAFIQRQERDTFGAVRQQQMISSHHLHLEDH 2059
                                                                             
  Fly  1314 ----------------------------------------------------------------- 1313

  Fly  2060 SASSSPAVAAWEQAERERSRSRSRSRDREDYSESVWDRAEVEGPASGSGSEKEREKRERERERLY 2124
                  |::..||                 |:                   ||:..:||      
  Fly  1314 ------AISQCEQ-----------------YA-------------------KEQGAQER------ 1330

  Fly  2125 EIRQVERERESHKVYQPAPPRVIQASMDTTGGHRREDRTGGLATFRTHMAQKYEHERKRKSSASS 2189
                                                                             
  Fly  1331 ----------------------------------------------------------------- 1330

  Fly  2190 GMREELDSMHMTTPPPVIVPAPVPPPSSTSPGLGVVSGVLMGSGSGGSTACLTYNRVPWKLRVRK 2254
                                                                   ..||:|..||
  Fly  1331 -------------------------------------------------------NAPWRLFFRK 1340

  Fly  2255 EVFQP-HEPIGPPVALDLLFAQVL-GDVFGVTPCLRITPQEKSSALNML--------HGHGVSVD 2309
            |:|.| |||....||.:|::.||: |..||...|      :|...|.|:        :...:|::
  Fly  1341 EIFAPWHEPTHDQVATNLIYQQVVRGVKFGEYRC------DKEEDLAMIAAQQYFIEYSTDMSME 1399

  Fly  2310 TLSNRNGSGAGGGGNGGQVRAL-------------------------VKRHLVDMAR-DWPLYFA 2348
            .|.....:........|..:|:                         :|..:|..|: .|||.|:
  Fly  1400 RLFTLLPNFIPDFCLSGVDKAIERWAALVLQAYKKSYYVKDKIAPLKIKEDIVSYAKYKWPLLFS 1464

  Fly  2349 RLFAV--QGAPLYP--DVSIMGVSHSGLYLARRDADYLIVVQAISFGEIQSAVTLPR-----PAA 2404
            |.:..  ...|..|  || |:.|:.:|:|:.   .|...|:..:||.|| :||:..:     ...
  Fly  1465 RFYEAYRNSGPNLPKNDV-IIAVNWTGVYVV---DDQEQVLLELSFPEI-TAVSSQKTNKVFTQT 1524

  Fly  2405 LQLNLRNGKHLALHAARAAAIQSMVTTFVQEFRKSQSKASTLSSGARAAAQTLNVPLERLESRQA 2469
            ..|:...|:.....:..|..|:.:|..|:...:| :||........||.:               
  Fly  1525 FSLSTVRGEEFTFQSPNAEDIRDLVVYFLDGLKK-RSKYVIALQDYRAPS--------------- 1573

  Fly  2470 HAQRNEHGVDGGS-----------RQNEQLQQSELHHHLQQQQQQQQQQQHHQQQQQQQQLEDAM 2523
                     ||.|           .::|...:|.|::                            
  Fly  1574 ---------DGTSFLSFFKGDLIILEDESCGESVLNN---------------------------- 1601

  Fly  2524 EEQHMATDHQQQQQQQLGQQQGQQQR--FLKQQSYLHSARKSNAGQQPSSLTN-GQVHHQEQMLQ 2585
                         ...:|:....|:|  |..:..|: ....|...|...:|.| .:.||..:   
  Fly  1602 -------------GWCIGRCDRSQERGDFPAETVYV-LPTLSKPPQDILALFNIEEAHHGRR--- 1649

  Fly  2586 QQQQQSQSLPHHDLDANYLQDESNGG-TPPSVTKYSLLQFAMQHFRNDQLRDADRHHERHQSAAN 2649
                              |...|||| ..|....::|:::|:.|||    ....|...:..:.::
  Fly  1650 ------------------LSMASNGGAVEPRDRPHTLMEYALDHFR----LPPKRTMSKTLTLSS 1692

  Fly  2650 RSYAELVKWQGHAIRLPLLR---LPNDLAPLALECFDCILRYCGDIP-----LDPDLTEVKCVYT 2706
            :...||.::....|:.||||   ...:.|..|...|..||:|.||:|     :..::|:      
  Fly  1693 KRSEELWRYSRDPIKAPLLRKLQSKEEFAEEACFAFAAILKYMGDLPSKRPRMGNEITD------ 1751

  Fly  2707 VLMHCH----KYLALRDEVYCQLMKQTTANRSPCPDSSQRAWRLLSILAAYFGCSDALRPYLMEH 2767
               |..    |:..||||:|||||||.|.||:..  |.:|.|.|:.:....|.||..|...|:..
  Fly  1752 ---HIFDGPLKHEILRDEIYCQLMKQLTDNRNRM--SEERGWELMWLATGLFACSQGLLKELLLF 1811

  Fly  2768 LTSAASDRRRSCHGTAAVCLTNLRKTARCGGRKNVPSVEEVTAVSAGRSARRQIYR---LPGGAE 2829
            |.:     ||  |..:...:..|:||.|.|.||..|...||.|:   :....||:.   .|...:
  Fly  1812 LRT-----RR--HPISQDSMHRLQKTIRHGQRKYPPHQVEVEAI---QHKTTQIFHKVYFPDDTD 1866

  Fly  2830 RVVNTRCSTVVADVIAELCALLGVESEAEQQEFSLYCIVQGDAFTMPLAADEYILDVT---TELL 2891
            .......||...|....:...|.:.:   .:.|||:..:.....::|  ..::..|..   |:.:
  Fly  1867 EAFEVDSSTRAKDFCNNISQRLSLRT---SEGFSLFVKIADKVISVP--EGDFFFDFVRHLTDWI 1926

  Fly  2892 KSGQP----------FYLIFCRSVWHFALKREPAPMPLYVEVLFNQVAPDYLEGLLLELPGNGVP 2946
            |..:|          :.:.|.:.:|...:..:.....|...  ::|..|..|.|           
  Fly  1927 KKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFH--YHQELPKLLRG----------- 1978

  Fly  2947 VPEMVR-DMARIAALLHRA------ADLSHVPAMKEIKFLLPKPALGIREIRPAQWVGLVQSAWP 3004
            ..:..| :.|::|||:.|.      .:|..:|.|  ::.|:|...:.|:.  .::|...:.:::.
  Fly  1979 YHKCSREEAAKLAALVFRVRFGENKQELQAIPQM--LRELIPSDIMKIQS--TSEWKRSIVASYN 2039

  Fly  3005 QVANLSPGQVKAQFLNVLATWPLFGSSFFAVKRIWAEEGPHVEDNHSPMWRDLILALNRRGVLFL 3069
            |...::....|..||.::..||.|||:||.||:.       .|.|:..|   |::|:|:.||..:
  Fly  2040 QDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQT-------TEPNYPEM---LLIAINKHGVSLI 2094

  Fly  3070 DPNTHETLQHWSFMEVISTRKVRSEDGALFLDMKVGNLMQQRVIRVQTEQAHEISRLVRQYITMA 3134
            .|.|.:.|....|     ||......|..:..|.:|||::...:..:|...:::..|:..||::.
  Fly  2095 HPVTKDILVTHPF-----TRISNWSSGNTYFHMTIGNLVRGSKLLCETSLGYKMDDLLTSYISLM 2154

  Fly  3135 QISQRDKREL 3144
            ..:....|.:
  Fly  2155 LTNMNKNRTI 2164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myo10ANP_001036269.2 MYSc 156..836 CDD:214580 309/690 (45%)
MYSc_Myo15 169..828 CDD:276838 297/669 (44%)
MyTH4 1014..1171 CDD:295320 16/157 (10%)
MyTH4 2704..2810 CDD:279165 39/110 (35%)
B41 2823..3033 CDD:214604 43/233 (18%)
FERM_B-lobe 2920..3025 CDD:271216 21/112 (19%)
FERM_C_MyoXV 3029..3138 CDD:270022 29/109 (27%)
ckNP_001285949.1 MYSc 64..733 CDD:214580 311/694 (45%)
MYSc_Myo7 77..721 CDD:276832 297/669 (44%)
MyTH4 <1138..1245 CDD:214535 28/182 (15%)
B41 1251..1467 CDD:214604 63/582 (11%)
FERM_B-lobe 1355..1439 CDD:271216 15/90 (17%)
FERM_C1_MyoVII 1461..1559 CDD:270019 26/104 (25%)
SH3 1560..1624 CDD:302595 15/129 (12%)
MyTH4 1701..1849 CDD:214535 55/169 (33%)
B41 1856..2068 CDD:214604 43/234 (18%)
FERM_M 1966..2068 CDD:278785 27/119 (23%)
FERM_C2_MyoVII 2064..2159 CDD:270020 29/110 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103688100
eggNOG 1 0.900 E2759_KOG4229
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127340
Panther 1 1.100 P PTHR13140
RoundUp 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.