DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1637 and PAP23

Sequence 1:NP_001285095.1 Gene:CG1637 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_193106.3 Gene:PAP23 AraportID:AT4G13700 Length:458 Species:Arabidopsis thaliana

Alignment Length:427 Identity:119/428 (28%)
Similarity:173/428 (40%) Gaps:105/428 (25%)


  Fly    20 PGIRSTPIDQDVDIVHYQPEQVHLSFGAERTDSEIVVTWST------RSLPPDQEVGAVSVVEYG 78
            |.:|...:..|.      |||:.|:..   |.:.:.|:|.|      :.:.|.......|.|.||
plant    53 PRLRKRNVSSDF------PEQIALALS---TPTSMWVSWVTGDAIVGKDVKPLDPSSIASEVWYG 108

  Fly    79 QLVDGQVRLTQQARGKATKF-----VDGGHKQATQFIHRVTLRDLEPNATYSYHCGSDF--GWSA 136
            : ..|...|  :.:|.||.:     .||.....:..||.|.:..|||...|.|.||...  ..|.
plant   109 K-EKGNYML--KKKGNATVYSQLYPSDGLLNYTSGIIHHVLIDGLEPETRYYYRCGDSSVPAMSE 170

  Fly   137 IFQFRTVPSASVDWSP-SLAIYGDMG--NENAQSLARLQQETQRGMYDAIIHVGDFAYDMNTKNA 198
            ...|.|:|..|.|..| .:|..||:|  :....::..|.:...    ..:|.|||..|....:. 
plant   171 EISFETLPLPSKDAYPHRIAFVGDLGLTSNTTTTIDHLMENDP----SLVIIVGDLTYANQYRT- 230

  Fly   199 RVG------------------------DEFMRQIETVAAYLPYMVVPGNHE-----EKFNFSNYR 234
             :|                        |.:.|.:|.:.:.:|.||:.||||     ....|.:|.
plant   231 -IGGKGVPCFSCSFPDAPIRETYQPRWDAWGRFMEPLTSKVPTMVIEGNHEIEPQASGITFKSYS 294

  Fly   235 ARFSMP----GGTENMFYSFDLGPVHFVGISTEVYYFLNYGLKPLVFQFEWLREDLAKANLPENR 295
            .||::|    |...|.:||||.|.||||.:...|.| .|.||     |:.||:|||:|.    :|
plant   295 ERFAVPASESGSNSNFYYSFDAGGVHFVMLGAYVDY-NNTGL-----QYAWLKEDLSKV----DR 349

  Fly   296 NKRPWIILYGHRP---MYCSNENDNDCTHSETLTRVGWPFVHMFGLEPLLYEFGVDVAIWAHEHS 357
            ...||::...|.|   .|.|:..:.:|...|              :|.|||::.||:....|.|:
plant   350 AVTPWLVATMHPPWYNSYSSHYQEFECMRQE--------------MEELLYQYRVDIVFAGHVHA 400

  Fly   358 YERLWPIYDYKVRNGTLKDSPYNDPSAPVHIVTGSAG 394
            |||:..||:|.:           ||..||:|..|..|
plant   401 YERMNRIYNYTL-----------DPCGPVYITIGDGG 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 119/428 (28%)
Pur_ac_phosph_N 38..142 CDD:293262 32/117 (27%)
MPP_PAPs 149..451 CDD:277318 81/286 (28%)
PAP23NP_193106.3 Pur_ac_phosph_N 65..176 CDD:293262 32/117 (27%)
MPP_PAPs 185..439 CDD:277318 80/284 (28%)
Metallophos 187..401 CDD:278574 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I1649
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D426430at2759
OrthoInspector 1 1.000 T124210
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.