DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1637 and Acp7

Sequence 1:NP_001285095.1 Gene:CG1637 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_017460193.1 Gene:Acp7 RGDID:1585399 Length:486 Species:Rattus norvegicus

Alignment Length:446 Identity:232/447 (52%)
Similarity:302/447 (68%) Gaps:21/447 (5%)


  Fly    14 LLVLLLPGIRSTPIDQDVDIVHYQPEQVHLSFGAERTDSEIVVTWSTRSLPPDQEVGAVSVVEYG 78
            ||:|...|::.||     :.....|||||||:..|  ...:.|||:|.:       .|.|.|::|
  Rat    12 LLLLFSLGVQGTP-----EYPRATPEQVHLSYPGE--PGTMTVTWTTWA-------PARSEVQFG 62

  Fly    79 QLVDGQVRLTQQARGKATKFVDGGHKQATQFIHRVTLRDLEPNATYSYHCGSDFGWSAIFQFRTV 143
            ..:.|.:.|  :|.|.::.|||||..:...:|||||||.|.|.|.|.|.|||..|||..|:| |.
  Rat    63 TQLSGPLPL--RAHGTSSAFVDGGVLRRKLYIHRVTLRKLLPGAHYVYRCGSSQGWSRRFRF-TA 124

  Fly   144 PSASVDWSPSLAIYGDMGNENAQSLARLQQETQRGMYDAIIHVGDFAYDMNTKNARVGDEFMRQI 208
            ....|.|||.||::||||.:|.::|.||:::||:||:||::|||||||:|:..||||||.|||.|
  Rat   125 LKNGVHWSPRLAVFGDMGADNPKALPRLRRDTQQGMFDAVLHVGDFAYNMDQDNARVGDRFMRLI 189

  Fly   209 ETVAAYLPYMVVPGNHEEKFNFSNYRARFSMPGGTENMFYSFDLGPVHFVGISTEVYYFLNYGLK 273
            |.|||.||||..|||||:::|||||:|||||||..|.::||:||||.|.:..|||||:||:||..
  Rat   190 EPVAASLPYMTCPGNHEQRYNFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRH 254

  Fly   274 PLVFQFEWLREDLAKANLPENRNKRPWIILYGHRPMYCSNENDNDCTHSETLTRVGWPFVHMFGL 338
            .:..||.||..||.|||  :||..|||||..|||||||||.:.:|||..|:..|.|.. ..:|||
  Rat   255 LVEKQFRWLERDLQKAN--KNRVARPWIITMGHRPMYCSNADLDDCTRHESRVRKGLQ-GKLFGL 316

  Fly   339 EPLLYEFGVDVAIWAHEHSYERLWPIYDYKVRNGTLKDSPYNDPSAPVHIVTGSAGCKEGREPFK 403
            |.|.:::|||:..||||||||||||||:|:|.||:| :.||.:|..||||:||||||:|...||.
  Rat   317 EDLFHKYGVDLEFWAHEHSYERLWPIYNYQVFNGSL-ERPYTNPRGPVHIITGSAGCEELLTPFV 380

  Fly   404 GKIPEWSAFHSQDYGYTRLKAHNRTHIHFEQVSDDKNGAIIDDFWLVKSKHGSYRN 459
            .|...|||...::|||||:...|.||:|.:|||||::|.|:||.|:|:...|..|:
  Rat   381 RKARPWSAVRVKEYGYTRMHILNGTHLHIQQVSDDQDGKIVDDVWVVRPLLGRMRS 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 226/429 (53%)
Pur_ac_phosph_N 38..142 CDD:293262 45/104 (43%)
MPP_PAPs 149..451 CDD:277318 177/302 (59%)
Acp7XP_017460193.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C278697850
eggNOG 1 0.900 E1_COG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H23924
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D331078at33208
OrthoFinder 1 1.000 FOG0006482
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45867
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.