DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1637 and acp7

Sequence 1:NP_001285095.1 Gene:CG1637 FlyBaseID:FBgn0030245 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001092720.1 Gene:acp7 ZFINID:ZDB-GENE-070615-9 Length:443 Species:Danio rerio

Alignment Length:452 Identity:240/453 (53%)
Similarity:310/453 (68%) Gaps:33/453 (7%)


  Fly    12 LLLLVLLLPGIRSTPIDQDVDIVHYQPEQVHLSFGAERTDSEIVVTWSTRSLPPDQEVGAVSVVE 76
            ||||:.:.......||..       ||||||:|:..  ..:.::||||:.:...       ||||
Zfish    12 LLLLLCVCAVFADVPIGT-------QPEQVHISYPG--VQNSMLVTWSSANKTD-------SVVE 60

  Fly    77 YGQLVDGQVRLTQQARGKATKFVDGGHKQATQFIHRVTLRDLEPNATYSYHCGSDFGWSAIFQFR 141
            || |..|:: .:..|.|.::.|::.|.:....:||||.|.||.|.|:|.|||||..|||.:| |.
Zfish    61 YG-LWGGKL-FSHSATGNSSIFINEGAEYRVMYIHRVLLTDLRPAASYVYHCGSGAGWSELF-FF 122

  Fly   142 TVPSASVDWSPSLAIYGDMGNENAQSLARLQQETQRGMYDAIIHVGDFAYDMNTKNARVGDEFMR 206
            |..:.||.:||..|::||:||||.|||:|||:|||.|.||.|:|:||||||:...|.|:|||||:
Zfish   123 TALNESVFFSPGFALFGDLGNENPQSLSRLQKETQIGTYDVILHIGDFAYDLYEDNGRIGDEFMK 187

  Fly   207 QIETVAAYLPYMVVPGNHEEKFNFSNYRARFSMPGGTENMFYSFDLGPVHFVGISTEVY-YFLNY 270
            ||:::|||:|||..|||||..||||.|||||||||.||.::||:::||.|.:..||||| |:|.|
Zfish   188 QIQSIAAYVPYMTCPGNHEWAFNFSQYRARFSMPGDTEGLWYSWNVGPAHIISFSTEVYFYYLEY 252

  Fly   271 GLKPLVFQFEWLREDLAKANLPENRNKRPWIILYGHRPMYCSNENDNDCTHSETLTRVG------ 329
            ||..|..|:||||.||.:||.||||.:|||||..|||||||||::|:||||.::..|:|      
Zfish   253 GLDLLFRQYEWLRADLQEANRPENRAERPWIITMGHRPMYCSNDDDDDCTHFQSYVRLGRNDTKP 317

  Fly   330 -WPFVHMFGLEPLLYEFGVDVAIWAHEHSYERLWPIYDYKVRNGTLKDSPYNDPSAPVHIVTGSA 393
             .|     |||.|.|::|||:.:|||||:||||||:|||||.||: .:.||.:|.|||||:||||
Zfish   318 PAP-----GLEELFYQYGVDLELWAHEHTYERLWPVYDYKVFNGS-SEEPYVNPKAPVHIITGSA 376

  Fly   394 GCKEGREPFKGKIPEWSAFHSQDYGYTRLKAHNRTHIHFEQVSDDKNGAIIDDFWLVKSKHG 455
            ||:|..:.|..|..:||||.|.|||||||:..|.||::.||||||:.|.:||...|||.|||
Zfish   377 GCREKHDGFIPKPRDWSAFRSTDYGYTRLQLINNTHLYLEQVSDDQYGKVIDQMTLVKEKHG 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1637NP_001285095.1 PLN02533 20..449 CDD:215292 230/437 (53%)
Pur_ac_phosph_N 38..142 CDD:293262 42/104 (40%)
MPP_PAPs 149..451 CDD:277318 184/310 (59%)
acp7NP_001092720.1 Pur_ac_phosph_N 31..123 CDD:293262 42/104 (40%)
MPP_PAPs 132..434 CDD:277318 184/308 (60%)
Metallophos 135..342 CDD:278574 126/212 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C278698959
eggNOG 1 0.900 E1_COG1409
Hieranoid 1 1.000
Homologene 1 1.000 H23924
Inparanoid 1 1.050 474 1.000 Inparanoid score I1427
OMA 1 1.010
OrthoDB 1 1.010 D331078at33208
OrthoFinder 1 1.000 FOG0006482
OrthoInspector 1 1.000 T1054850
orthoMCL 1 0.900 OOG5_128526
Panther 1 1.100 LDO PTHR45867
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3332
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.