DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2186 and rbm33

DIOPT Version :8

Sequence 1:NP_001259433.1 Gene:CG2186 / 32017 FlyBaseID:FBgn0030243 Length:1128 Species:Drosophila melanogaster
Sequence 2:XP_012820255.1 Gene:rbm33 / 550090 XenbaseID:XB-GENE-492091 Length:1316 Species:Xenopus tropicalis

Alignment Length:1386 Identity:293/1387 (21%)
Similarity:457/1387 (33%) Gaps:447/1387 (32%)


  Fly     6 DDLLNYELGDDIDDQALLGADEDELLLSDEELEKDVTSEVKQQMRAEAEEWAQEQIRQHERKHKE 70
            ||..:.||.||:.::.:|...:..|.||||||..|:       ::::.||               
 Frog    28 DDDWDSELEDDLLEEDVLPGKKSSLDLSDEELNDDL-------LQSDEEE--------------- 70

  Fly    71 QLQADATAATEVTVAATATA------EVAPTLRAQPELASSPAPDPVPAKPLVAQVEKHVDTAH- 128
              |....:|..||::..|||      |::.::...||:..   |:....:.:..:||:....|. 
 Frog    71 --QDPNYSAQGVTLSLNATAGGLTSFELSKSINEDPEVEE---PEMGEDEAVYEEVEEPEGCAED 130

  Fly   129 AAVAAEPAKEL---------------------------------VSASRSESPQQQAKEEAPPAD 160
            .|.|.|.|.||                                 ....:.:...|:|:..|...:
 Frog   131 FADAYEEADELPEEHTEYMDEETTDEVLDLEINEPLDEFQEEVYTQTYKRQKMMQEAEFAANDVE 195

  Fly   161 CAEKEATQNNGNSEEQAENAGSQSEAERGLGLCSLLASSQESLPSASSASVISDPREDDEEREER 225
            ..|:||.:.......:.::..:.||        .:...|||.:|....   .||..:|:||...|
 Frog   196 ETEEEAIEETAEESIETQDPANDSE--------EVPVESQEMVPETKE---YSDEDDDEEEGGGR 249

  Fly   226 TNYKTA-----------SERSDNNLRQQQE-----HAHMSPYQHQQRRLHGH--GDKPRVGGGGR 272
            ..:|:.           |.|...|:.:..|     .|.:..::..:|...|.  ..:.|.||...
 Frog   250 IRFKSERKEGTIIRLSDSTRERRNIPETLELSAEAKASLQEFEEMERMRKGRYCAKRGRRGGMNP 314

  Fly   273 FMHGQQQQQ------QQQQSQMGKPPRGIGTRHHL--------LRNP------SPSFGIQQQRMG 317
            ...|:|:..      ::|:|..|:|.|.:..::.:        .|||      ||....:|:.:|
 Frog   315 MFRGEQRHDSNDRRIREQRSSHGQPIRSLFHQNQIQPLLPMPRSRNPSSDSMTSPPPQEKQRMVG 379

  Fly   318 MAGMQPPPQRYGM------------PGQYPATQPPNQS------------------PQQAPTNTQ 352
            ...|..|.|...:            |.|.|....||||                  |...|.|..
 Frog   380 KPLMSTPQQPKNIHINPHFKGNVVAPVQVPLLPAPNQSRPPMGSPRFPGMPDFQHVPSPVPGNFN 444

  Fly   353 QP-------HSAPASP------LHTP--THSHMMHHSHNPNG---GVL--HHLLP----HPHEQV 393
            .|       .:.|..|      |..|  .:.|:..|.:.|.|   .:|  :|.||    ||..|.
 Frog   445 PPPRLQEPWRNPPPQPERETFFLGEPRFPNQHLFDHRNPPPGPPPPLLNNNHSLPNQGQHPFNQP 509

  Fly   394 RVGLLQPPPLAY-------------APNPG-------------------GYRNGALLGPGPGPGL 426
            ..|..||.|...             .|.||                   |:.......|||.||.
 Frog   510 GPGFNQPSPQPRFNQPGPQPNFSQPGPQPGFPQPGPGPQQNFNQPGPPPGFNQPGFSQPGPQPGF 574

  Fly   427 HQQHQSPHQQQSGMRP----PLYRNAPPSYGYDQ-GHPPQHPQQFMRPHNGWRPQGDNARMQRPP 486
            :|....|...|||.:|    |.:....|..|::| ||.|...||      |....|.|    :||
 Frog   575 NQPGPQPGFTQSGPQPVFNQPGFGQPGPQPGFNQVGHQPGFNQQ------GMNQPGYN----QPP 629

  Fly   487 LQTLPPHMMPGAPPNYANGMGMRGPPPQQQQSQQPPQQQPAPQQAGNPLQQAVNPGQPPQQPNG- 550
            .....|...|.||          |||...||.   |..|||..|:|...::.|.|..|...|.| 
 Frog   630 NVGPQPAFNPPAP----------GPPGFNQQG---PLPQPAFNQSGFSRERPVRPNAPSPGPMGI 681

  Fly   551 -------------PPQQQ-----GSSSVPRVSKVLINPNFKGGVEAATNKFIKETHFMPAINSEA 597
                         ||:.|     |...:|.     |.||.:|.::|.... ..:.|..|......
 Frog   682 PPFNQSSPNRHFPPPRPQFPPGPGQPFMPH-----IQPNIQGPMQAPMQP-PHQPHHTPGPLKPP 740

  Fly   598 ELLRQQVEFINKNRQYIEKRRMERS----PPSSGSSTGAASSGQAGERRRTRSR-SRSRGRSYSP 657
            ..:.||     ..||:::..:|..:    ||.........:....|.::...:| |..|....:|
 Frog   741 MPIPQQ-----PFRQHLQSPQMPLNNRLRPPKPRQGVPPQNMTMGGNQQMMHTRNSNLRELPIAP 800

  Fly   658 VKRVERERERERERERDRERDRERDRERYGANRAAGNRGFRRASSRDRDENRGAASTASAQGAGG 722
                                                      |||.||::.: ..|.|..:..|.
 Frog   801 ------------------------------------------ASSLDRNKMK-PNSAAQMKPVGT 822

  Fly   723 SASSGAAPPKRRRSGSAGGGTARNPFSGEPRG---RPSETGSRSMPSDEDEETRNYRLEIEKQKQ 784
            :|      |:.|..|      ..||...:...   :..|...|....|||||||||||:||:||:
 Frog   823 TA------PQTRPVG------VGNPHVAKQANASIQMQEEVKREQFPDEDEETRNYRLKIEEQKR 875

  Fly   785 LREKIMRDKELKRRRAA-----------------------EEKLHEEKRAEQH------------ 814
            |||.|::.|||:|::.|                       :::|.::::.:|.            
 Frog   876 LREAILKQKELRRQQQAGARKKELLERLSHQQQQQQQQQQQQQLQQQQQQQQQQQQQQQQQQQQQ 940

  Fly   815 ---------NTSPARDDQEVAAGQGSAAPTPA--ASKHRP-------TASAGERKVISLKRRDDQ 861
                     ..:||..:::.:....:..|.|:  .::.||       |...|...|..|::....
 Frog   941 VQQQTPPGPQQAPAEQEKKTSPVTNNVNPIPSLTGTQIRPNVKNRLLTQKPGTPPVNVLQKIPTV 1005

  Fly   862 DASSVRSRQAQGS---------QSNAQAGQGQQQQQAARKQLTAAKIAPEAKRSITDHLAPSSKQ 917
            ..::..|...||.         |:........|:....|..:.||::.|:....:..        
 Frog  1006 QHTTGASTPVQGQPKKIIKKTVQNRVMTDNPVQKVHQVRPAVNAAQLGPQQIAKVAS-------- 1062

  Fly   918 HHHHHQQHHQTAAAPA---RTVVLGSGAVAG---GTPPKPRDKLRLGTPSDDEVELDYDDDDLLL 976
                .|...|.||.||   |||:..|.:.:|   .||.|.| .::|.....|...:..:.:..:.
 Frog  1063 ----VQGQPQAAARPAATKRTVMQRSNSASGEAANTPTKVR-VIKLSAAGGDNANVSAEGNLPVQ 1122

  Fly   977 DEEDRLLATPSPPPQ-----------------KASSKRSATPEPLVVKRNHKAMRGGSSTSAPSF 1024
            ..:.::.....||.|                 |.:..:....:|......|         ..|.|
 Frog  1123 SLQPKINPQQRPPFQQRLQQQQLQQQQQRPIRKVTIAKGTVQQPPQQNLYH---------GPPPF 1178

  Fly  1025 SSNQRRVVLKPTSNG---SSSSGGDQQQLSHSGRQRDRRRGGE---DSALQRKGGVG-------- 1075
            ..:.|::...|.|.|   .:|..|..|......|.|.|..||:   ...:..|..:.        
 Frog  1179 QGHARQIRSHPESAGPRIMNSVQGHHQPNKVIMRGRGRGVGGQMGRGRMMPNKQNLRVVECKPQP 1243

  Fly  1076 ---SVGGSSSSGSGGGIFDRL 1093
               ||.|.|||.:.|.:.:.|
 Frog  1244 CAVSVEGLSSSTTDGQLRNML 1264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2186NP_001259433.1 PABP-1234 <288..366 CDD:130689 28/137 (20%)
rbm33XP_012820255.1 HARE-HTH <98..172 CDD:294801 12/77 (16%)
RRM_SF 1246..1312 CDD:240668 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005858
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5746
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.