DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and MAP65-1

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001190542.1 Gene:MAP65-1 / 835616 AraportID:AT5G55230 Length:616 Species:Arabidopsis thaliana

Alignment Length:555 Identity:112/555 - (20%)
Similarity:207/555 - (37%) Gaps:127/555 - (22%)


  Fly    33 ACEDCLARLKDHVHTF---YTDLRKETSDKEQGILNDIAVLRNEASGLRRLLHKAVDIGERPDDV 94
            |.|....:.::.|..|   .:.::|...|...|:.|::.::......|::|           || 
plant   110 ALEQLWQQKEERVREFSDVQSQIQKICGDIAGGLSNEVPIVDESDLSLKKL-----------DD- 162

  Fly    95 PMEIWYIKLEKYIEQLRKELVSRRAEIRELLHQQQQLCDELGEQPLSLLADPLPLPEE------- 152
                    .:..:::|:||...|..::.|.:.....||..||...||.:.:..|..:|       
plant   163 --------FQSQLQELQKEKSDRLRKVLEFVSTVHDLCAVLGLDFLSTVTEVHPSLDEDTSVQSK 219

  Fly   153 ------MDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIKLLELQLRTDSEKRL-------LNAD 204
                  :....:.:..|:|.:.|||:.:.||...:   |.|..|....|.|:.|       :::.
plant   220 SISNETLSRLAKTVLTLKDDKKQRLQKLQELATQL---IDLWNLMDTPDEERELFDHVTCNISSS 281

  Fly   205 NHKLT-PYAYVRLQEMDKEFADQV---------------QDLIDRIDEMRGKIECLWQRLRMTDE 253
            ..::| |.|..|      :..:||               |.|:..|.....|.|....||   |:
plant   282 VDEVTVPGALAR------DLIEQVIYIALINLPMSSLRNQLLLANIHVKFVKAEVEVDRL---DQ 337

  Fly   254 YAMRRVREATSYNQCTYDILREELERCQAMRQQNLIAFIEQLRIEINEWWDLSLKSTEERRRFTT 318
            ....|::|.....|       .|||...|           :..:|:|.      :|..||.....
plant   338 LKASRMKEIAFKKQ-------SELEEIYA-----------RAHVEVNP------ESARERIMSLI 378

  Fly   319 YYCDTQTEDVLEQFEKELDNLKEFYNSNRKIFELYANRGELWTRMEALEAKA------NDPNRFN 377
            ...:.:..::|...:.::...||...|.:.|.:    |.|.|  |.|.|.::      .|.||::
plant   379 DSGNVEPTELLADMDSQISKAKEEAFSRKDILD----RVEKW--MSACEEESWLEDYNRDQNRYS 437

  Fly   378 -NRGGQL-LKEEKERKTIMSRLPKIDQQITELVQVYMSETHTPFLVHGVDIL----------ERM 430
             :||..| ||..::.:.::|::|.:...:....:.:..|....|...||.:|          :..
plant   438 ASRGAHLNLKRAEKARILVSKIPAMVDTLVAKTRAWEEEHSMSFAYDGVPLLAMLDEYGMLRQER 502

  Fly   431 SADWERHRQSKK---QPSAQKKDGSNT-SGQMKPPMVPLTPNTQKSNRGIHGSTSSLKKTPTKAN 491
            ..:..|.|:.||   ||..:::...:| ....:|.....|...:.:|.|.:|:.:.........|
plant   503 EEEKRRLREQKKVQEQPHVEQESAFSTRPSPARPVSAKKTVGPRANNGGANGTHNRRLSLNANQN 567

  Fly   492 AS-TTAMSTG---NLHKRRHPQHHNTNSPQPAAAA 522
            .| :||...|   .|::...|.::...|.:.||::
plant   568 GSRSTAKEAGRRETLNRPAAPTNYVAISKEEAASS 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 110/552 (20%)
MAP65-1NP_001190542.1 MAP65_ASE1 56..616 CDD:281928 112/555 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2331
OMA 1 1.010
OrthoDB 1 1.010 D272248at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128835
Panther 1 1.100 O PTHR19321
Phylome 1 0.910 0.636 Consistency score
76.980

Return to query results.
Submit another query.