DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and PLE

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_199973.1 Gene:PLE / 835234 AraportID:AT5G51600 Length:707 Species:Arabidopsis thaliana

Alignment Length:582 Identity:129/583 (22%)
Similarity:220/583 (38%) Gaps:147/583 (25%)


  Fly    86 DIGERPDDVPMEIWYIKLEKYIEQLRKELVSR----RAEIRELL----HQQQQLCDELGEQPLSL 142
            ::||...|  .:...::||:...::.:..|.:    ||::|:.:    .|...:|..:||:|:.:
plant    29 EVGETETD--RDQMLLELERECLEVYRRKVDQANRCRAQLRQAIADAEAQLAAICSAMGERPVHI 91

  Fly   143 -------------LADPLPLPEEMDPFREHLAQLRDQRVQRLRDMDELRQNIK------------ 182
                         |...||..|||   ::...:.|:|.:..:..:|.:..:||            
plant    92 RQSDQSVGSLKQELGRILPELEEM---QKRKVERRNQFIVVMEQIDSITNDIKGQGELVHSEPLI 153

  Fly   183 -------RNIKLLELQLRT-DSEK--RLLNADNHKLTPYAYVRLQEMD-KEFADQV--------- 227
                   |.::.|..||:. ..||  |:.....|..|.|::..:..|| .|...||         
plant   154 DETNLSMRKLEELHCQLQVLQKEKIDRVETIRKHLCTLYSHCSVLGMDFNEVVGQVNPTLSDPEG 218

  Fly   228 -QDLIDRIDEMRGK-----IECLWQRLRMTDEYAMRR----------VREATSYNQCTYDILREE 276
             :.|.|...|..|.     :|...||::...:.|...          :.|...|...|.:|...|
plant   219 PRSLSDHTIEKLGAAVQKLMEVKIQRMQRLQDLATTMLELWNLMDTPIEEQQEYQHITCNIAASE 283

  Fly   277 LERCQA-MRQQNLIAFIEQLRIEINE-----WWDLSLKSTEE-----RRRFTTYYCDTQTED--- 327
            .|..:| ...::.|.::|...:.::|     ..:|.||...|     |:.......|:..:.   
plant   284 HEITEANSLSEDFIKYVEAEVVRLDEVKASKMKELVLKKRSELEEICRKTHLLPVSDSAIDQTIV 348

  Fly   328 -----------VLEQFEKELDNLKEFYNSNRKIFE-----LYANRGELWTRMEALEAKANDPNRF 376
                       |||..|:.:..:||...|.::|.|     |.|...|.|     ||....|.||:
plant   349 AIESGIVDATMVLEHLEQHISKIKEEALSRKEILERVEKWLSACDEESW-----LEEYNRDDNRY 408

  Fly   377 N-NRGGQL-LKEEKERKTIMSRLPKIDQQITELVQVYMSETHTPFLVHGVDILERMSADWERHRQ 439
            | .||..| ||..::.:.::::||.:.:.:.....|:..|....||..|:.:|. |..::...||
plant   409 NAGRGAHLTLKRAEKARNLVTKLPGMVEALASKTIVWEQENGIEFLYDGIRLLS-MLEEYNILRQ 472

  Fly   440 SKKQPSAQKKDGSNTSGQMKPPMVPLTPNTQKSNRGIHGSTSSLKKTPTKANASTTA--MSTGNL 502
            .:::...:::|.....||:           ......::||    |.:|:|......|  ||||..
plant   473 EREEEHRRQRDQKKLQGQL-----------IAEQEALYGS----KPSPSKPLGGKKAPRMSTGGA 522

  Fly   503 HKRR---HPQHHNTNSPQPAAAAKRN-----------LIASLECNNASRKVCVNGQKLLKSP 550
            ..||   ....|.|..|...|..:.|           .||.|    .|||..:|..::|:||
plant   523 SNRRLSLGAAMHQTPKPNKKADHRHNDGALSNGRRGLDIAGL----PSRKQSMNPSEMLQSP 580

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 129/583 (22%)
PLENP_199973.1 MAP65_ASE1 52..607 CDD:281928 124/558 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2331
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D272248at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19321
Phylome 1 0.910 0.600 Consistency score
55.070

Return to query results.
Submit another query.