DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and MAP65-2

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_567756.1 Gene:MAP65-2 / 828783 AraportID:AT4G26760 Length:578 Species:Arabidopsis thaliana

Alignment Length:584 Identity:122/585 (21%)
Similarity:228/585 (39%) Gaps:121/585 (21%)


  Fly    20 ELHAMWSRMFEP---------QACEDCLARLKDHVHTFYTDLRKETSDKEQGILNDIAVLRNEAS 75
            :|..:|..:.|.         |..|:||     :|:....:|..::..:....|:|..|   |.|
plant    22 KLQEIWDEVGESDEERDKLLLQIEEECL-----NVYKKKVELAAKSRAELLQTLSDATV---ELS 78

  Fly    76 GLRRLLHKA--VDIGERPDDVPMEIWYIKLEKYIEQLRKELVSRRAEIRELLHQQQQLCDELG-- 136
            .|...|.:.  :||.::......| ....:...:|||.::...|.....::..|.|::|:|:.  
plant    79 NLTTALGEKSYIDIPDKTSGTIKE-QLSAIAPALEQLWQQKEERVRAFSDVQSQIQKICEEIAGG 142

  Fly   137 ---------EQPLSLLADPLPLPEEMDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIKLLELQ- 191
                     |..|||        :.:|.|:..|.:|:.::..||:.:.|....:.....:|.|. 
plant   143 LNNGPHVVDETDLSL--------KRLDDFQRKLQELQKEKSDRLQKVLEFVSTVHDLCAVLRLDF 199

  Fly   192 LRTDSE-------------------------KRLLNADNHKLTPYAYVRLQEMDKEFADQVQD-- 229
            |.|.:|                         |.:|.....|:.     ||::: :|.|.|:.|  
plant   200 LSTVTEVHPSLDEANGVQTKSISNETLARLAKTVLTLKEDKMQ-----RLKKL-QELATQLTDLW 258

  Fly   230 -LIDRIDEMRGKIECLWQRLRMTDEYAMRRVREATSYNQCTYDILRE---ELERCQAMRQQNL-- 288
             |:|..||.|...:.:...:..:       |.|.|:......|::.:   |::|...::...:  
plant   259 NLMDTSDEERELFDHVTSNISAS-------VHEVTASGALALDLIEQAEVEVDRLDQLKSSRMKE 316

  Fly   289 IAFIEQLRI-EINEWWDLSLKSTEERRRFTTYY--CDTQTEDVLEQFEKELDNLKEFYNSNRKIF 350
            |||.:|..: ||.....:.:|....|.|..:..  .:|:..::|...:.::...||...|.::|.
plant   317 IAFKKQSELEEIYARAHIEIKPEVVRERIMSLIDAGNTEPTELLADMDSQIAKAKEEAFSRKEIL 381

  Fly   351 ELYANRGELWTRMEALEAKA------NDPNRFN-NRGGQL-LKEEKERKTIMSRLPKIDQQITEL 407
            :    |.|.|  |.|.|.::      .|.||:: :||..| ||..::.:.::|::..:...:...
plant   382 D----RVEKW--MSACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKITAMVDTLIAK 440

  Fly   408 VQVYMSETHTPFLVHGVDILE--------RMSADWERHR--QSKKQPSAQKKDGSNTSGQMKPPM 462
            .:.:..|....|...||.:|.        |...:.|:.|  :.|||......|..:..|. ||. 
plant   441 TRAWEEENSMSFEYDGVPLLAMLDEYTMLRQEREDEKRRLKEQKKQQEQPHTDQESAFGS-KPS- 503

  Fly   463 VPLTPNTQKSNRGIHGSTSSLKKTPTK-----ANASTTAMSTGNLHKRRHPQHHNTNSPQPAAA 521
             |..|.:.|...|...:...|.:||.:     :|.:.:.....:|:|...|.:...|:...||:
plant   504 -PARPVSAKKPVGTRVNGGGLNETPMRRLSMNSNQNGSKSKRDSLNKIASPSNIVANTKDDAAS 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 117/560 (21%)
MAP65-2NP_567756.1 MAP65_ASE1 50..542 CDD:281928 109/526 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2331
OMA 1 1.010
OrthoDB 1 1.010 D272248at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128835
Panther 1 1.100 O PTHR19321
Phylome 1 0.910 0.607 Consistency score
76.980

Return to query results.
Submit another query.