DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and MAP65-5

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001318376.1 Gene:MAP65-5 / 818454 AraportID:AT2G38720 Length:550 Species:Arabidopsis thaliana

Alignment Length:550 Identity:108/550 (20%)
Similarity:218/550 (40%) Gaps:109/550 (20%)


  Fly    19 DELHAMWSRMFE------------PQACEDCLARLKDHVHTFYTDLRKETSDKEQGILNDIAVLR 71
            :||..:|..:.|            .|.|.|...:..:....|..:|::..:..|.          
plant    14 EELQMIWDEIGESYNERDKMLLELEQECLDIYNKKVEKTRKFRAELQRSLAQAEA---------- 68

  Fly    72 NEASGLRRLLHKAVDIGERPDDVPMEIWYIKLEKYIEQLRKELVSRRAEIRELLHQQQQLCDELG 136
             |.:.|...|.:.|...::...:..:|..:|  ..:|.|..:...||.|:.|.|:|..::...:.
plant    69 -EIASLMSALGEKVSFAKKEGSLKEQISSVK--PVLEDLLMKKDRRRKELSETLNQIAEITSNIA 130

  Fly   137 EQPLSLLA----DPLPLPE-EMDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIKLLELQLRTDS 196
            ....::.:    |...|.: ::|..|..|..||:::..||:.::.....:....::|....    
plant   131 GNDYTVSSGSEVDESDLTQRKLDELRADLQDLRNEKAVRLQKVNSYISAVHELSEILSFDF---- 191

  Fly   197 EKRLLNADNHKLTPYAYVRLQEMDKEFADQVQDLI--------DRIDEMRG---KIECLWQRLRM 250
             .:.||:.:..||.::....:.:..:...:..:|:        :|:.:::|   .::.|| .|..
plant   192 -SKALNSVHSSLTEFSKTHSKSISNDTLARFTELVKSLKAEKHERLLKLQGLGRSMQELW-NLME 254

  Fly   251 TDEYAMRRVREATSY----------NQC-TYDILRE---ELERCQAMRQQNL--IAFIEQLRIE- 298
            |.....||....:|.          ..| :.||:||   |:.|..:::...:  :.|..|..:| 
plant   255 TPMDERRRFDHCSSLLSSLPDDALKKGCLSLDIIREAEDEVRRLNSLKSSKMKELVFKRQCELEE 319

  Fly   299 --------INEWWDLSLKSTEERRRFTTYYCDTQTEDVLEQFEKELDNLKEFYNSNRKIFE---- 351
                    ||.  |.:.||..|    .....|....|:|...:.:::..:|...|.::|.:    
plant   320 ICRGNHMDINS--DAARKSLVE----LIESGDGDLSDILASIDGQIEKAREEALSRKEILDKVDK 378

  Fly   352 -LYANRGELWTRMEALEAKANDPNRFNN-RGG-QLLKEEKERKTIMSRLPKIDQQITELVQVYMS 413
             .:|...|.|     |:....|.|||:. ||. :.||..::.::::|::|.:...:|..|:.:..
plant   379 WRHAKEEETW-----LDDYEKDENRFSAVRGAHKNLKRAEKARSLISKIPAMVDVLTTKVKAWEK 438

  Fly   414 ETHTPFLVHGVDILERMSAD---WERHRQSKKQPSAQKKDGSNTSGQMKPPMVPLTPNTQKSNRG 475
            |...|||.....:|:.:..|   ..:..:.|:|...||:    ..||:.         |:|..: 
plant   439 ERGVPFLCDKQPLLQTLEDDIVIRAQREEEKRQFREQKR----LQGQLA---------TEKEAK- 489

  Fly   476 IHGSTSSLKKTPTKANASTTAMSTGNLHKR 505
             :||.|: ||.|...:.:|..::...:.:|
plant   490 -YGSKSA-KKKPLGQSLNTDNVTKTPIGRR 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 102/521 (20%)
MAP65-5NP_001318376.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2331
OMA 1 1.010
OrthoDB 1 1.010 D272248at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19321
Phylome 00.000 Not matched by this tool.
55.170

Return to query results.
Submit another query.