DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and ATMAP65-6

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_178300.3 Gene:ATMAP65-6 / 814722 AraportID:AT2G01910 Length:608 Species:Arabidopsis thaliana

Alignment Length:577 Identity:114/578 (20%)
Similarity:204/578 (35%) Gaps:172/578 (30%)


  Fly    77 LRRLLHKAVDIGE---RPDDVPMEIWYIKLEKYIEQLRKELVSRRAEIRELLHQQQQLCDELGEQ 138
            ||.|....|:|||   ..|.:.||     ||:...|:.:..|...|..:..|||.   ...:..:
plant    22 LRELQKIWVEIGETETEKDRMLME-----LERECLQIYQRKVDEAANSKAKLHQS---VASIEAE 78

  Fly   139 PLSLLA--------DPLPLPEEMDPFREHLA-------QLRDQRVQRLRDMDELRQNIKR----- 183
            ..||:|        .|:.|.:.....:|.||       :||.|:.:|::...:::..|::     
plant    79 VASLMAALGVLNINSPIKLDKGSKSLKEKLAAVTPLVEELRIQKEERMKQFSDIKAQIEKISGEI 143

  Fly   184 -------NIKLLELQLRTDSEKRLLNADNHKLTPYAYVRLQEMDKEFADQVQDLIDRIDEMRG-- 239
                   | |.:.:.|..:.:...|...|...|     .|:.:.||.:|::..::..::|:..  
plant   144 SGYSDHLN-KAMNISLTLEEQDLTLRNLNEYQT-----HLRTLQKEKSDRLNKVLGYVNEVHALC 202

  Fly   240 ---------KIECLWQRLRMTDEYAMRRVREATSYNQCTYDILREELERCQAMRQQNLIAFIEQL 295
                     .:..:...|..||:      .::|:.:..|.:.|...:::.:..|:.. ...::.:
plant   203 GVLGVDFSQTVSAVHPSLHRTDQ------EQSTNISDSTLEGLEHMIQKLKTERKSR-FQKLKDV 260

  Fly   296 RIEINEWWDLSLKSTEERRRF--TTYYCDTQ----TE------DVLEQFEKELDNLKEFYNSNRK 348
            ...:.|.|:|.....|:|.:|  .||...:.    ||      :.:||...|:|:|.:...|..|
plant   261 VASLFELWNLMDTPQEDRTKFGKVTYVVRSSEANITEPGILSTETIEQVSTEVDSLSKLKASRMK 325

  Fly   349 IF----------------------------------------ELYAN--------------RGEL 359
            ..                                        ||.||              |.::
plant   326 ELVMKRRSELEDLCRLTHIQPDTSTSAEKSTALIDSGLVDPSELLANIEMQINKIKDEAQSRKDI 390

  Fly   360 WTRMEA----------LEAKANDPNRFN-NRGGQL-LKEEKERKTIMSRLPKIDQQITELVQVYM 412
            ..|::.          ||....|.||:: .|||.: ||..:..:..::::|.:...:.:...|:.
plant   391 MDRIDRWLSACEEENWLEEYNLDENRYSAGRGGHVNLKRAERARVTINKIPGMVDTLIKKTLVWE 455

  Fly   413 SETHTPFLVHG---VDILERMSADWERHRQSKKQPSAQKKD------------GSNTSGQMKPPM 462
            .:....||..|   |:|||......::..:.||:...|||.            ||      ||  
plant   456 EDMQKSFLYDGVRLVNILEDYKLTRKQQEEEKKRYRDQKKRQDLLLTQRESIYGS------KP-- 512

  Fly   463 VPLTPNTQKSNR-----GIHGSTSSLKKTPTKANASTTAMSTGNLHKRRHPQHHNTN 514
               :|....|.|     .|.....|:..||.:.:..||.... .|..|.:..||..|
plant   513 ---SPRRSSSFRKPNGFNISNGNGSVPPTPRRGSVGTTTPDV-LLTPRSYSGHHRQN 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 114/578 (20%)
ATMAP65-6NP_178300.3 MAP65_ASE1 52..>509 CDD:281928 84/473 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2331
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D272248at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19321
Phylome 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.