DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and zgc:86764

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001002684.1 Gene:zgc:86764 / 797431 ZFINID:ZDB-GENE-040718-435 Length:579 Species:Danio rerio

Alignment Length:580 Identity:137/581 (24%)
Similarity:251/581 (43%) Gaps:83/581 (14%)


  Fly    22 HAM------WSR--MFEPQACEDCLARLKDHVHTFYTDLRKETSDKEQGILNDIAVLRNEASGLR 78
            |||      |..  :.|.|..|. :..:|.|:......:..|.......|..||...:.:...| 
Zfish    19 HAMARLVDIWDSIGIMEDQRVER-MQTVKKHIDGLLHSMIMEEEALRHRIKTDIITFQKQLDTL- 81

  Fly    79 RLLHKAVDIGERPDDVPMEIWYIKLEK----YIEQLRKELVSRRAEIRELLHQQQQLCDELGEQP 139
                 .:::...|..:..::..:::||    ::|.|:||...|..|:.:...|.::||..|...|
Zfish    82 -----CLELTLEPFKLEEKLTVLQMEKNLRCHVESLQKEKNERLREMNDFKKQDEELCVTLCADP 141

  Fly   140 LSLLADPLPLPEEMDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIKLLELQLRTDSEKR----- 199
            ..:....:|...::...:||:.:|..::..|::....||::|:..::.|..:..:..|:.     
Zfish   142 YYIPTGSVPSRTQLQELKEHVERLNKEKESRVKVFSGLREDIRNLMEELGHEPESSLERESICPD 206

  Fly   200 ----LLNADNHKLTPYAYVRLQEMDKEFADQVQDLIDRIDEMRGKIECLWQRLRMTDEYAMRRVR 260
                ||..||.|.......:| |:.||      .||...|.::.:...||.||...:..|  .|.
Zfish   207 ADIFLLTHDNIKALKLLLSQL-EIKKE------SLISARDSLKERAMSLWNRLSCPESEA--EVF 262

  Fly   261 EATSYNQCTYDILREE--LERCQAMRQQNLIAFIEQLRIEINEWWDLSLKSTEERRRFTTYYCDT 323
            :..:.:..:.||.|.:  :|..:.:::..|...|.::|.|:...||..:...::|:.|..::||.
Zfish   263 QEPAMSTLSDDIRRWQRFVEHLEELQKAQLEEVINKVRQELVVLWDKCMFGPDQRQAFDVHFCDD 327

  Fly   324 Q-TEDVLEQFEKELDNLKEFYNSNRKIFELYANRGELWTRMEALEAKANDPNRFNNRGGQLLKEE 387
            | |.::|...:.||..:|.||...:.|.|........|...:..|.||.||:||:||||.||:|.
Zfish   328 QYTTELLALHDSELQRMKIFYEEAQPILEDLEKWKRNWALFQEFERKAADPSRFSNRGGSLLRET 392

  Fly   388 KERKTIMSRLPKIDQQITELVQVYMSETHTPFLVHGVDILERMSADWERHRQSKKQPSAQKKDGS 452
            |||..:...|||:::::...|:.:.......|||:|..:::.:|:.||.||..|.:...::....
Zfish   393 KERGKVQKLLPKLEEELRGRVEDWEIVKGLSFLVYGQRVMDYISSQWEEHRLQKDKEKNERMSKK 457

  Fly   453 NTSGQMKPPMVPLTPNTQKSNRGIHGSTSSLKKTPTKANASTTAMSTGNLHKRRHPQHHNTNSPQ 517
            ..:.|.|.|       |:::    ||.|.:...||.|...:.:.::                   
Zfish   458 TETPQFKTP-------TKRA----HGMTCAATPTPNKIRKTPSQLA------------------- 492

  Fly   518 PAAAAKRNLIASLECNNASRKVCVNGQKLLKSPQRKVRVLEYSVRRGKGSGRPSTGSRNP 577
            |.:|...::.::....:::..:||.|:     ||       .|.:|.| :...|||.|.|
Zfish   493 PRSATVSSISSASSSGSSTTFLCVPGR-----PQ-------LSAKRTK-TTETSTGPRLP 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 130/559 (23%)
zgc:86764NP_001002684.1 MAP65_ASE1 41..>489 CDD:281928 115/475 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4302
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D272248at2759
OrthoFinder 1 1.000 FOG0002025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128835
Panther 1 1.100 O PTHR19321
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.