DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and prc1a

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_021326115.1 Gene:prc1a / 259194 ZFINID:ZDB-GENE-020801-3 Length:612 Species:Danio rerio

Alignment Length:606 Identity:148/607 (24%)
Similarity:266/607 (44%) Gaps:84/607 (14%)


  Fly     1 MLSSE-HKARILALTAEHFDELHAMWSRMFEPQACEDCLARLKDHVHTFYTDLRKETSDKEQG-- 62
            |..|| |.|..::...:..::|..:|..:..|   ||...:..|.||....:|......:|:|  
Zfish     1 MRKSEIHAAESVSSLNKALNQLKDIWEEIGIP---EDQRLQRTDAVHMHIKNLLDMMIAEEEGLK 62

  Fly    63 --ILNDIAVLRNEASGLRRLLHKAVDIGERPDDVPMEIWYIKLEK----YIEQLRKELVSRRAEI 121
              :|..|...|||.|.|...|.  :...:..|.:.|    ::|||    .::.:.||..||:.|:
Zfish    63 KRLLTSIEACRNEVSSLCDELQ--LQEFQEEDGLTM----LQLEKDLRTQVKLMLKEKSSRQTEL 121

  Fly   122 RELLHQQQQLCDELGEQPLSLLADPLPLPEEMDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIK 186
            :.|:.|.|.|||.|.|....:..:.:|..:::..:|:|:.....::.:|..:..|:::.|...::
Zfish   122 KSLIQQDQDLCDVLCEDLFPIHPERVPSQQQLQNYRQHINTRNQEKERRHAEFVEMKRQITVLME 186

  Fly   187 LLELQLRTDSEKRLLNADNHKLTPYAYVRLQEMDKEFADQVQDLIDRID-----------EMRGK 240
            .||....|..||..:..|.....         :..|....::.|:.:::           .::.:
Zfish   187 DLEQSPDTTFEKDAVCEDEDAFC---------LSVENISSLKVLLRQLETRKAESEALSVSIQAR 242

  Fly   241 IECLWQRLRMTDEYAMRRVREATSYNQCTYDILREELERCQAMRQQNLIAFIEQLRIEINEWWDL 305
            ||.||:.|.:..|.....:....|..:...:.|:.|.:|.:.::::|:...|..:|.||.::|:.
Zfish   243 IEELWEMLEIPLEERDGLMLHTHSSTKSRLNALQAEFQRMEGLKKKNIERVIRTIRSEIVKFWEK 307

  Fly   306 SLKSTEERRRFTTYYCDTQTEDVLEQFEKELDNLKEFYNSNRKIFELYANRGELWTRMEALEAKA 370
            ...|.|:||.|..::.|...:|:|.:.|:||:.||:.|...:::::..:.....||..:.||.||
Zfish   308 CYFSQEQRRAFLPFHSDDLDDDLLREHEQELERLKQNYTEYKELYDAVSTWSSNWTLYQELEKKA 372

  Fly   371 NDPNRFNNRGGQLLKEEKERKTIMSRLPKIDQQITELVQVYMSETHTPFLVHGVDILERMSADWE 435
            .||:|||||||.||||||:|..:...|||:::.:...:..:.:.....|.|:|...|:.:...|.
Zfish   373 TDPSRFNNRGGNLLKEEKQRVDLQKSLPKLEKSLKAQIDQWEAAQCKEFRVNGQQFLQYVEEQWS 437

  Fly   436 RHRQSK-------------------------KQPSAQKKDGSNTSGQMK-----PPMVPLTPNTQ 470
            .||..|                         :.|:.::..|:.|.|:.:     ..|...|||| 
Zfish   438 HHRMQKEMEKQERQMKKIKQTEEDLLYGTVIRTPTKRRIAGTPTPGKTRKLTSASSMCSSTPNT- 501

  Fly   471 KSNRGIHGSTSSLKKTP---TKANASTTAMSTGNLHKRRHPQ--HHNTNSPQPAAAAKRNLIASL 530
             :.|.|..|.|  .:.|   :|.||.|.|       :.|.|:  ..|..:....:.|.|.:.||.
Zfish   502 -TLRSICSSPS--MRPPLSSSKLNARTPA-------RGRTPRGLERNKENLSHLSGALRTMTASP 556

  Fly   531 ECNNASRKVCVNGQKLLKSPQ 551
            ..|.:...|..:..:..|..:
Zfish   557 HSNYSITSVASSYSEFAKDSE 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 139/571 (24%)
prc1aXP_021326115.1 MAP65_ASE1 37..578 CDD:309213 138/568 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H133826
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D272248at2759
OrthoFinder 1 1.000 FOG0002025
OrthoInspector 1 1.000 T128822
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19321
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.