DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and mcp1

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_593128.1 Gene:mcp1 / 2542755 PomBaseID:SPAC1687.10 Length:661 Species:Schizosaccharomyces pombe

Alignment Length:641 Identity:119/641 - (18%)
Similarity:219/641 - (34%) Gaps:217/641 - (33%)


  Fly    36 DCLARLKDHVHTFYTDLRKETSDKEQGILNDIAVLRNEASGLRRLLHK-AVDIGERPDDVPM--- 96
            :||.       |::..:|...:.|           :|||..:.:.:.: :|.:||..|:|..   
pombe    90 ECLV-------TYHNGIRAIYNTK-----------KNEAKNMYKEIERLSVILGESVDEVNFVNG 136

  Fly    97 ---EIWYIKLEKYIEQLRKELVSRRAEIRELLHQQQQLCDELGEQPLSLLADPLPLPEEMDPFRE 158
               :|..||||:...:|.:            |||..:|..|...:                 .:|
pombe   137 DFEDISDIKLEQLSAKLNE------------LHQIYRLRKEKNIE-----------------IKE 172

  Fly   159 HLAQLRDQ-RVQRLRDMDELRQNIKRNIKLLELQLRTDSEKRLLNADNHKLTPYAYVRLQEMDKE 222
            .|.:|:|. .::.....|:|.:|..:::.:.:.:||...|.|                       
pombe   173 ELKKLQDSLSIKLSMPADDLSKNGIKHLIIYKEKLRFSLESR----------------------- 214

  Fly   223 FADQVQDLIDRIDEMRGKIECLWQRLRMTDEYAMRRVREATSYNQCTYDILREELERCQAMRQQN 287
             ..:|.::::.:..|.||        ..|.|.       .|:|:..|..:...||   .:||:..
pombe   215 -KSRVDEIVNEMKNMCGK--------NPTSEL-------PTNYSDKTLTLWENEL---SSMRKVY 260

  Fly   288 LIAFIEQLRIEINEWWDLS--LKSTEERRRFTTYYCD--TQTEDVLEQFEKELDNLK-------E 341
            .:.:..:.......:..|:  :..:::...||:.:.:  ....::::..::|:.||:       |
pombe   261 FVKYKTEYEFLQKRYLSLARIMFVSKKEMLFTSQFKEIPNVNRELIQSMKQEIGNLEVDLHLQGE 325

  Fly   342 FYNSNRKIFELYANRGELWTRMEALEAKANDPNRFN--NRGGQLLK-----------EEKER--- 390
            ..|..|:...|.:...:...||:.|...|:.|....  .:..||||           |:.|:   
pombe   326 LNNMIRRYLLLESRVYKESQRMKVLSGSASQPFTLKRLQKDFQLLKAKLICALREWEEDNEKKIY 390

  Fly   391 ---KTIMSRLPKIDQQITELVQVYMSETHTPFLVHGVDIL---ERMSADWERHRQSKKQPSAQKK 449
               |.:.|||                     .::|...||   |.:|::.......:..|.|:|.
pombe   391 VFGKPLSSRL---------------------LMIHSPPILQNQENISSNDNSKSSPESSPPARKT 434

  Fly   450 DGS-------NTSGQMK-------------PPMV-------PLTPNTQKSNRGIHGSTSS-LKKT 486
            .|.       |...|.|             .|::       |.|.:..||.|.:..::|. |.|.
pombe   435 TGKIENKKLRNIDVQSKKSIRFPLRLASHEEPLIDRMVNQSPDTRSVSKSKRLVRETSSGCLFKN 499

  Fly   487 PTKANASTTAMSTGNLHKRRHPQHHNTNSP--QPAAAAKRNLIASLECNNASRKVCVNGQKLLKS 549
            .:|:|         .|..||....|....|  .|.|::....:..:             :::|.|
pombe   500 HSKSN---------TLSPRRKGSRHGPREPCLSPDASSSSIPVTDI-------------KEILPS 542

  Fly   550 ----PQRKVRVLEYSVRRGKGSGRPSTGSRNPQKIRPIPKIHVRPPSGEENESPDE 601
                |...|::      .|..:...|...|  |.|.|:  :...||.||...|.|:
pombe   543 QHDTPHNSVKL------TGSSTTPASVSLR--QMIEPL--LSRTPPKGEFTNSLDD 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 117/636 (18%)
mcp1NP_593128.1 PRK03918 <2..>234 CDD:235175 39/222 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19321
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.