DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and Prc1

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006540918.1 Gene:Prc1 / 233406 MGIID:1858961 Length:656 Species:Mus musculus

Alignment Length:558 Identity:146/558 - (26%)
Similarity:266/558 - (47%) Gaps:52/558 - (9%)


  Fly    12 ALTAEHFDELHAMWSRMFEPQACEDCLAR---LKDHVHTFYTDLRKETSDKEQGILNDIAVLRNE 73
            |||     .|..:|..:..|:  |..|.|   :|.|:......:..|.....:.:|..|::.:.|
Mouse    18 ALT-----HLREIWELIGIPE--EQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKE 75

  Fly    74 ASGLRRLLHKAVDIGERPDDVPMEIWYIKLEK----YIEQLRKELVSRRAEIRELLHQQQQLCDE 134
            .|.|      ..::..:|.....:...::|||    .:|.:||:...|:.|::.|..|:|:|.|.
Mouse    76 LSTL------CSELQVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDI 134

  Fly   135 LGEQPLSLLADPLPLPEEMDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIKLLELQLRTDSEKR 199
            |...|..:.:..:|..||:..||:.:|.||:.:..|..:...:::.|...::.||....|..|:.
Mouse   135 LCMPPCDVDSTSVPTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERD 199

  Fly   200 LLNADNHK--LTPYAYVRLQEMDKEFADQVQDLIDRIDEMRGKIECLWQRLRMTDEYAMRRVREA 262
            ::..|...  |:......||::.|:...:........:.:|.:|..||.||::.:|  .|...||
Mouse   200 VVCEDESAFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEE--EREPVEA 262

  Fly   263 --TSYNQCTYDILREELERCQAMRQQNLIAFIEQLRIEINEWWDLSLKSTEERRRFTTYYCDTQT 325
              |.......:.|:.|::|.:.::.||:...||::|:|:.::||....|.|:|:.|..||.:..|
Mouse   263 IMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYT 327

  Fly   326 EDVLEQFEKELDNLKEFYNSNRKIFELYANRGELWTRMEALEAKANDPNRFNNRGGQLLKEEKER 390
            |::|...:.|:..|:.:|:.::::|:......|.|......|.||:||.||.||||.||||||||
Mouse   328 ENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKER 392

  Fly   391 KTIMSRLPKIDQQITELVQVYMSETHTPFLVHGVDILERMSADWERHRQSKKQPSAQK--KDGSN 453
            ..:...|||:::::...::.:..|..|.|:|:|...:|.::..||.||..|::...::  |:...
Mouse   393 AKLQKTLPKLEEELKARIEQWEQEHSTAFVVNGQKFMEYVTEQWELHRLEKERAKQERQLKNKKQ 457

  Fly   454 TSGQMKPPMVPLTPNTQKSNRGIHGSTSSLKKTPTKANASTTAMSTGNLHKRRHP-----QHHNT 513
            |..:|.....|.||:.:.      |.|.  ||:......:||.||:...:....|     .:.:.
Mouse   458 TEAEMLYGSTPRTPSKRP------GQTP--KKSGKVRKMNTTTMSSATPNSSIRPVFGGSVYRSP 514

  Fly   514 NSPQPAAAAKRNLIASLECNNASRKVCVNGQKLLKSPQ 551
            .|..|.:.:| :::.||         | :|:|..::.|
Mouse   515 MSRLPPSGSK-SVVTSL---------C-SGKKTPRAAQ 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 139/534 (26%)
Prc1XP_006540918.1 CENP-Q 34..>130 CDD:289839 22/101 (22%)
MAP65_ASE1 37..597 CDD:281928 139/532 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4302
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3528
Isobase 1 0.950 0 Normalized mean entropy S5674
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002025
OrthoInspector 1 1.000 T617033
orthoMCL 1 0.900 OOG5_128835
Panther 1 1.100 O PTHR19321
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3175
TreeFam 1 0.960
1211.810

Return to query results.
Submit another query.