DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and prc1

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_017947450.1 Gene:prc1 / 100216075 XenbaseID:XB-GENE-963901 Length:617 Species:Xenopus tropicalis

Alignment Length:620 Identity:159/620 - (25%)
Similarity:266/620 - (42%) Gaps:128/620 - (20%)


  Fly    30 EPQAC-EDCLARLKD---------------------HVHTFYTDLRKETSDKEQGILNDIAVLRN 72
            |..|| ...||||:|                     ||:...|.:.:|..:.:|.:|..|.|.|.
 Frog    16 ESVACLNSALARLRDIWEEIGIPEDQRLQRTDAVKRHVNLLLTRMIEEEENLKQRLLKSIDVCRK 80

  Fly    73 EASGLRRLLHKAVDIGERPDDVPMEIWYIKLEK----YIEQLRKELVSRRAEIRELLHQQQQLCD 133
            |.:.|      .:::...|.:...|...::|||    .:|.:.|:...|..|::.|..:.|.|||
 Frog    81 ELNTL------CMELQLPPFEEEEESTILQLEKDLRTRVEVMLKQKKERMHELKLLKERDQDLCD 139

  Fly   134 ELGEQPLSLLADPLPLPEEMDPFREHLAQLRDQRVQR--------------LRDMDELRQ-NIKR 183
            .|...|..:....:|..:|:|.||.|||.|..::..|              :.::|.|.. :.:|
 Frog   140 ILCTSPYHIDGACVPSLQELDQFRRHLAGLSAEKEHREAEFKSTKKQIILCMEELDRLPDTSFER 204

  Fly   184 NIKLLELQLRTDSEKRLLNADNHKLTPYAYVRLQEMDKEFADQVQDLIDRIDEMRGKIECLWQRL 248
            ::      :..|.|...|:.:|  ||....:.:|..:::..:||     ..:|:|.||..||:||
 Frog   205 DV------VCEDEEAFCLSKEN--LTALQELLIQLEEQKMKNQV-----LCEELRSKITELWERL 256

  Fly   249 RMTDEYAMRRVREA-----TSYNQCTYDILREELERCQAMRQQNLIAFIEQLRIEINEWWDLSLK 308
            ::::|     .|:|     |.....|...|:||.:|.|.::.||:...:|.:|:||:.:||....
 Frog   257 QISEE-----ERDAFGEYMTGSKGKTIKALQEEFDRLQELKLQNIKRIVEAIRLEISSYWDKCFY 316

  Fly   309 STEERRRFTTYYCDTQTEDVLEQFEKELDNLKEFYNSNRKIFELYANRGELWTRMEALEAKANDP 373
            |..:|:.|..:..:...||:|...:.|:..:|::|.|::::|:......|.|......:.||.||
 Frog   317 SAAQRQAFVPFSSEDYNEDLLCIHDAEISRIKQYYESHKEMFDGVQKWEENWRLFLEFDKKATDP 381

  Fly   374 NRFNNRGGQLLKEEKERKTIMSRLPKIDQQITELVQVYMSETHTPFLVHGVDILERMSADWERHR 438
            |||.||||.||||||:|..:...|||:::::...:..:..|....|.|:....::.::..||...
 Frog   382 NRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKTSIIAWEQEQEQEFFVNEKKFMDYVAEQWETFH 446

  Fly   439 QSK---KQPSAQKKDGSNTSGQMKPPMVPLTPNTQKSNRGIHGSTSSLKKTPTKANASTTAMSTG 500
            |.|   ||....||                  |.|......:||.   .|||             
 Frog   447 QDKEREKQERLMKK------------------NRQLEEEMYYGSA---PKTP------------- 477

  Fly   501 NLHKRRHPQHHNTNSPQPAAAAKRNLIASLECNNASRKVCVNGQKLLKSPQRKVRVLEYSVRRGK 565
              :|||.|   ..::|. :...|.|..:....:|::.:...:| .:..||..:..|.        
 Frog   478 --NKRRVP---GPSTPS-SKCRKLNGTSISSSSNSTLRSAFSG-TMCHSPVSRPPVC-------- 527

  Fly   566 GSGRPSTGSRNPQKI--RPIPKIHVRPPSGEENES 598
             .|:|...||.|.::  .|.||   |....:||.|
 Frog   528 -GGKPGLPSRTPTRVFKTPQPK---RLERNKENMS 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 155/611 (25%)
prc1XP_017947450.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4302
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D272248at2759
OrthoFinder 1 1.000 FOG0002025
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.780

Return to query results.
Submit another query.