DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sofe and prc1.2

DIOPT Version :8

Sequence 1:NP_001285092.1 Gene:sofe / 32016 FlyBaseID:FBgn0030242 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_012823157.1 Gene:prc1.2 / 100125796 XenbaseID:XB-GENE-1020943 Length:581 Species:Xenopus tropicalis

Alignment Length:514 Identity:136/515 (26%)
Similarity:237/515 (46%) Gaps:61/515 (12%)


  Fly    38 LARLKDHVHTFYTDLRKETSDKEQGILNDIAVLRNEASGLRRLLHKAVDIGERPDDVPMEIWYIK 102
            :..:|.|:......:..|..|.:..|...|...:.|   |:.|.|: :.|.|...|..|.:...:
 Frog    44 MEEVKKHIEELLNRMISEEVDMKDRIEKSIQNCQKE---LKLLCHE-LSIEEYVVDDGMTVLQTE 104

  Fly   103 --LEKYIEQLRKELVSRRAEIRELLHQQQQLCDELGEQPLSLLADPLPLPEEMDPFREHLAQLRD 165
              |...:|.|..|...|..|:|.|.....:||.:|...|..:....:|..::::..:||:....:
 Frog   105 RDLRVRLEMLLNEKNDRLEELRLLQQTDIELCTDLCVTPYYIPTGSIPSRQQLEELKEHIKVQTE 169

  Fly   166 QRVQRLRDMDELRQNIKRNIKLLELQ---------LRTDSEKRLLNADNHKLTPYAYVRLQEMDK 221
            ::.|||:....||..|::.:..:..|         :..|.|...|.|||.|.......:| |:.|
 Frog   170 EKKQRLQVFSTLRAEIRQCLDEMGRQPENSLEQDAICEDEEAFFLTADNIKALRVLKEQL-ELKK 233

  Fly   222 EFADQVQDLIDRIDEMRGKIECLWQRLRMTDEYAMRRVREATSYNQ--C----TYDILREELERC 280
            |   .:|..:..:.|   :::.||.||.:..:      .:.|....  |    :..:...||.|.
 Frog   234 E---TMQSTLSALKE---RVQVLWSRLLVPQD------EQETCQKSPLCPIANSIKLWENELIRL 286

  Fly   281 QAMRQQNLIAFIEQLRIEINEWWDLSLKSTEERRRFTTYYCDTQTEDVLEQFEKELDNLKEFYNS 345
            :.:::.||...:.::|.|:..:||....|||:|:.||.||.|..||::|.|.::|:..::..|..
 Frog   287 EDLKKANLKDVVLKIREELKMYWDKCFYSTEQRKSFTPYYNDDFTEELLSQHDEEVVRMRLQYEK 351

  Fly   346 NRKIFELYANRGEL-WTRMEALEAKANDPNRFNNRGGQLLKEEKERKTIMSRLPKIDQQITELVQ 409
            .|::.:. .|:.|. |.:...||.||.|||||:||||.||||||||..:...|.|:::::...::
 Frog   352 CREMLDA-VNKWETSWGQFVLLEKKATDPNRFSNRGGSLLKEEKERAKLQKMLSKLEEELKSRIE 415

  Fly   410 VYMSETHTPFLVHGVDILERMSADWERHRQSKKQPSAQKKDGSNTSGQMKPPMVPL--------- 465
            .:.:|....||:.|...::.:::.||.|   |||...:|:|.|....:..|...|:         
 Frog   416 AWETEQGCAFLLKGHRFMDYITSQWEMH---KKQKEREKQDRSLKKEEHTPFKTPIKRPAGSCIQ 477

  Fly   466 -TPNTQKSNRGIHGSTSSLKKTPTKANASTTAMSTGNLHKRRHPQHHNTNSPQPAAAAK 523
             ||:.:  .|.::|:::|.....|.:| |:||.||.:         .:.|...|.:..|
 Frog   478 GTPSNK--TRKLNGTSNSAMSRTTVSN-SSTASSTSS---------QSLNGKMPLSTIK 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sofeNP_001285092.1 MAP65_ASE1 36..598 CDD:281928 136/515 (26%)
prc1.2XP_012823157.1 MAP65_ASE1 41..>497 CDD:281928 126/476 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4302
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D272248at2759
OrthoFinder 1 1.000 FOG0002025
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3175
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.