DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: X11Lbeta and Apba2

Sequence 1:NP_727440.3 Gene:X11Lbeta FlyBaseID:FBgn0052677 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_113968.1 Gene:Apba2 RGDID:620845 Length:750 Species:Rattus norvegicus

Alignment Length:913 Identity:345/914 (38%)
Similarity:441/914 (48%) Gaps:217/914 (24%)


  Fly  1274 TTASTTTDSNGGVGGVGHHLVATLVASPNNEQAKSQCQTQLQSHPPKTLSLDQSPSNHSKVFKNI 1338
            :|||:..|.....|.:.|.      ..|.||..    :..|:|:.|..|                
  Rat     8 STASSMLDHRARPGPIPHD------QEPENEDT----ELPLESYVPTGL---------------- 46

  Fly  1339 DPELDSLYSIGVFHRPDTVQMTPPPPAPAPHRKPNNNGCSSGVVNTNGSLAGGSNDVDLLQPSSK 1403
              ||.:|       |||    :|.|.....|....:...||..||....    ..|.|...|..:
  Rat    47 --ELGTL-------RPD----SPTPEEQECHNHSPDGDSSSDYVNNTSE----EEDYDEGLPEEE 94

  Fly  1404 -----HTPLAAAISSTLQRSSPTSTITGNGIGNGSGKTRSAGSNCSSS---ANGGMPPPIPERTN 1460
                 :........|.|:                       |.:|:..   |:|..|....|...
  Rat    95 EGVTYYIRYCPEDDSYLE-----------------------GMDCNGEEYLAHGAHPVDTDECQE 136

  Fly  1461 LVSAVQRSPSPGPNSPVWLSRHLDGGAGKDLLESGSDNHSKNHSADEEDVDTDLETDRLLGHQRL 1525
            .|.  ..:.|.||::      |..|.       ..|..:..:|....||..|.||.     |.:.
  Rat   137 AVE--DWTDSVGPHT------HSHGA-------ENSQEYPDSHLPIPEDDPTVLEV-----HDQE 181

  Fly  1526 DDQGYYDENKSWDRKPRSLLSKISPKQQIPSTKTRNGYNALLSSTPELPPPIPPK--GQSGLGLG 1588
            :| |:|                      .||.::...|             .||:  |.:|....
  Rat   182 ED-GHY----------------------CPSKESYQDY-------------YPPETNGNTGGASP 210

  Fly  1589 LTLGAGNGG-----KLLDLVGGMVQRSLSRSS-SEHSEKSLSKMP-ISGGDLCAGGVDVVASTVA 1646
            ..:..|:|.     :.:|.:...::.|||.:| :..||.|...|| :..||              
  Rat   211 YRMRRGDGDLEEQEEDIDQIVAEIKMSLSMTSITSASEASPEHMPELDPGD-------------- 261

  Fly  1647 ATSATVVASTPALGSPGNGGGSERSAAEMANPGGAVKLSEQEIGTINGGSVMPLGSGSGTGSGAG 1711
                    ||.|......|.|..|   :.|.|...              ::.|....||...   
  Rat   262 --------STEACSPSDTGRGPSR---QEARPKSL--------------NLPPEVKHSGDPQ--- 298

  Fly  1712 SGAGSGTGTNAAVVANSNANNNVGGG---GGGGNNSSGSGAGSNSNSGEKKVKKSKSKEGGAV-- 1771
              .|..|.|.............|..|   ......|..:|...|:|..|.| |.:......||  
  Rat   299 --RGLKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDNNNIPETK-KVASFPSFVAVPG 360

  Fly  1772 ------LIEGVLFRAKYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKALA----------PDGDVQ 1820
                  ||:|::|.|.|||||||:.|..|:|:.|||||:|||||:|.:.          .:||.|
  Rat   361 PCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQ 425

  Fly  1821 PSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRF---VPQD-IDDAP- 1880
            ..|||||||||::|.|||.|.:|.||||||||||||||||::||||||||.   ..|| |:..| 
  Rat   426 TLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPG 490

  Fly  1881 --KPNRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGI--EDHRFVKEMDYQEVLNSQE 1941
              :..:..|||||||||::||.|||||||||.|||.|||:||||  ||   :.:.:|.:::|:||
  Rat   491 AQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPED---LSQKEYSDIINTQE 552

  Fly  1942 IFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGD 2006
            ::.|:|..|:..|..||:.:.|.||||||||:|||||||:||||::||:|:.|.|||.|:|:|||
  Rat   553 MYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGD 617

  Fly  2007 QLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVIC 2071
            |:::|||.|||||||:|||..||..||||.||..:|.|.||..|.||||:.|||||||||||:||
  Rat   618 QIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIIC 682

  Fly  2072 SLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGEILMKTMPTSMFRLLTGQENP 2136
            ||:||||||||||||||||||||.|||||..|||||..|:.|||||.|||||.:|||||||||.|
  Rat   683 SLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETP 747

  Fly  2137 IYI 2139
            :||
  Rat   748 LYI 750

Known Domains:


GeneSequenceDomainRegion External IDIdentity
X11LbetaNP_727440.3 PTB_X11 1770..1924 CDD:269919 105/181 (58%)
PDZ_signaling 1957..2042 CDD:238492 56/85 (66%)
PDZ_signaling 2047..2120 CDD:238492 58/73 (79%)
Apba2NP_113968.1 DUF3210 <24..336 CDD:288359 87/478 (18%)
STXBP1-binding 185..271 25/143 (17%)
PTB_X11 364..536 CDD:269919 102/172 (59%)
PDZ 569..652 CDD:278991 55/83 (66%)
PDZ_signaling 658..731 CDD:238492 58/73 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112699264
eggNOG 1 0.900 E1_KOG3605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 504 1.000 Inparanoid score I1266
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001899
OrthoInspector 1 1.000 T131303
orthoMCL 1 0.900 OOG5_130749
Panther 1 1.100 O PTHR12345
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.