DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: X11Lbeta and apba1b

Sequence 1:NP_727440.3 Gene:X11Lbeta FlyBaseID:FBgn0052677 Length:2139 Species:Drosophila melanogaster
Sequence 2:XP_005155643.1 Gene:apba1b ZFINID:ZDB-GENE-070925-3 Length:971 Species:Danio rerio

Alignment Length:1167 Identity:368/1168 (32%)
Similarity:515/1168 (44%) Gaps:310/1168 (27%)


  Fly  1074 GQQPQLQAQLTAQPMSGARRHYSGSPLMRDFDFFLDSTSRSSGERDADQDGLNHNQLLSTSSGHG 1138
            |..|....|....|:.|.|..:....|...               ||:..|.:|:.....:..| 
Zfish    14 GPPPHRSKQPNGTPLEGGRPRWRPCQLHNP---------------DAESQGQHHHHYHHQAHQH- 62

  Fly  1139 GGVGVSGGLGVGPG------GGHNYRYSPETTDYDSNCGDLDSLSGEMNGGVSTSCSNYAKFYAS 1197
                .||.....|.      .|...|..||:.|.::..|.                         
Zfish    63 ----ASGSSRAPPRHRRRHVPGQAQRRRPESGDSEARAGQ------------------------- 98

  Fly  1198 AMPVLEDGLSSGHTSDTENNNNNQKNLQQSTVNQGGQCPTSLSGSTSIGGSGGISMLMDMKRIST 1262
             .|  :.|.|..|.|. |....::...|.....|..:.|.....|..:              :|.
Zfish    99 -QP--KPGASKHHRSG-ERLYQHRYRQQHKDEEQHVKTPPKEQASEPL--------------LSP 145

  Fly  1263 NHSLNSMNNQTTTASTTTDS-NGGVGGVGHHLVATLVASPNNEQAKSQCQTQLQSHPPKTLSLDQ 1326
            :.|...:...:......||. :.....:.|.....:...|..|||:|              |:||
Zfish   146 DDSSQDLLTPSPQDEPVTDELDESSPDLSHSSDTQINRDPEQEQAES--------------SVDQ 196

  Fly  1327 SPSN-HSKVFKN------------------------IDPELDSLYSIGVFHRPDTVQMTP----- 1361
            ...| |.:.|||                        :.|::.|.      .||::.:.:|     
Zfish   197 PEENVHREEFKNPCEEELVKVNEVEDLSTQIPEEDYVPPKIASK------SRPESKRTSPLRVDV 255

  Fly  1362 PPPAPAPHRKPNNNGCSSGVVNTNGSLAGGSNDVDLLQP---SSKHTPLAAAISSTLQRSSPT-- 1421
            ||.|.:||:          ::|               :|   |.:..|.:....::..:|.||  
Zfish   256 PPFATSPHQ----------IIN---------------KPFFQSPRSFPESLRRYNSDPKSYPTFF 295

  Fly  1422 ---STITGNGIGNGSGKTRSAGSNCSSSA-NGGMPPPIPERTNLVSAVQRSPSPGPNSPVWLSRH 1482
               ...|.|.....|.::...|....|.| ....|...|:.|      :...:|....|      
Zfish   296 NNNYACTRNDKEFDSPRSHDEGDLSDSEAYTDSYPESHPKDT------ETDLNPAFEEP------ 348

  Fly  1483 LDGGAGKDLLESGSDNHSKNHSADEEDVDTDLETD---------RLLGHQRLDDQGYYDENKSWD 1538
                      ::...|:|.  |.||.|...|||.:         ||  |...:..|  ||.:|:.
Zfish   349 ----------QAYEMNYSM--SMDECDDQQDLEEEPNPHSAVGSRL--HHYDEQSG--DEAESFG 397

  Fly  1539 RKPRSLLSKISPKQQIP----------STKTRNGYNALLSSTPELPPPIPPKGQSGLGLGLTLGA 1593
            |. |:.|.|.|....:|          |..|:|.     :...|....:|.|...     :|...
Zfish   398 RS-RAHLRKTSSSTSLPLEVHPQDDETSEMTQNS-----TDLQEEVEDVPEKQDQ-----ITESC 451

  Fly  1594 GNGGKLLDLVGGMVQRSLSRSSSEHSEKSLSK--MPISGGDLCAGGVDVVASTVAATSATVVAST 1656
            ...|..:.|    ..|.:..:..|...|::..  ||    |.....|.|:...|    :.|..|.
Zfish   452 KATGDAVSL----AIRDIKEAIEEVKTKTVRSPYMP----DKITEPVWVMRQDV----SPVEESH 504

  Fly  1657 PALGS-PGNGGGSERSAAEMANPGGAVKLSEQEIGTINGGSVMPLGSGSGTGSGAGSGAGSGTGT 1720
            |.:.| |.:.....:|:.:.|.|     :.:.|         .|||:.|           ||   
Zfish   505 PQIHSYPQSPCQISQSSPQYAAP-----IQDAE---------PPLGAES-----------SG--- 541

  Fly  1721 NAAVVANSNANNNVGGGGGGGNNSSGSGAGSNSNSGEKKVKKSKSKEGGAV----------LIEG 1775
                |.:.:.:..:                 ..|...::.:||.:.....|          ||:|
Zfish   542 ----VLHQDQDQEL-----------------CPNVPSEEQRKSLASFPTYVDVPGPCDPEDLIDG 585

  Fly  1776 VLFRAKYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKALAPDGDVQ---------PS-TEVDLFIS 1830
            ::|.|.|||||||:.|..||||.||.||:||:||::.......::         || ||||||||
Zfish   586 IIFAANYLGSTQLLSERTPTKSARMQQAQEAMSRVRTAQAQAKIRNKQGTESGPPSCTEVDLFIS 650

  Fly  1831 TEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFV-----PQDIDDAPKPNRTP---- 1886
            |::|.||:...::.||||.|||||||||||::|||||||:.:     .:::|.|...:..|    
Zfish   651 TQRIKVLSAYTQDTMMDHPLRTISYIADIGNMVVLMARRKMIRSQSAQENLDTAETQHTNPARDD 715

  Fly  1887 ----KMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHRFVKEMDYQEVLNSQEIFGDEL 1947
                |||||||||::||.|||||||||.|||.|||:|||| |...:.:.:|.::||:|:::.|:|
Zfish   716 RRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGI-DPEDLSQREYSDLLNTQDMYNDDL 779

  Fly  1948 EIFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAIN 2012
            ..|:|.|..::|.:.|.||||||||||||||||:||||:||:||..|.||:.|:||||||::.:|
Zfish   780 IHFSKSENCRDVYIEKQKGEILGVVIVESGWGSILPTVIIASLMHGGPAAKSGRLNIGDQIMTVN 844

  Fly  2013 GLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGG 2077
            |.|||||||||||:.||..|:|:.:|..:|.|.||..|.|:||:.:||||||||||:||||:|||
Zfish   845 GTSLVGLPLSTCQSIIKGLKSQSRIKMNIVRCPPVTMVLIRRPDLRYQLGFSVQNGIICSLMRGG 909

  Fly  2078 IAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGEILMKTMPTSMFRLLTGQENPIYI 2139
            |||||||||||||||||.|||||.||||||::|:.:||||.|||||.:|:||||.||.|:||
Zfish   910 IAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI 971

Known Domains:


GeneSequenceDomainRegion External IDIdentity
X11LbetaNP_727440.3 PTB_X11 1770..1924 CDD:269919 95/187 (51%)
PDZ_signaling 1957..2042 CDD:238492 54/85 (64%)
PDZ_signaling 2047..2120 CDD:238492 56/73 (77%)
apba1bXP_005155643.1 PTB_X11 579..757 CDD:269919 95/179 (53%)
PDZ 790..873 CDD:278991 54/83 (65%)
PDZ_signaling 879..952 CDD:238492 56/73 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112572706
eggNOG 1 0.900 E1_KOG3605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 493 1.000 Inparanoid score I1329
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128826
orthoMCL 1 0.900 OOG5_130749
Panther 1 1.100 O PTHR12345
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.