DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXA2 and unpg

Sequence 1:NP_006726.1 Gene:HOXA2 HGNCID:5103 Length:376 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:394 Identity:93/395 (24%)
Similarity:135/395 (34%) Gaps:152/395 (38%)


Human    16 PSLAECLTS----FPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRH-GAGGR--- 72
            |:|...|.:    |.|.|     :.:..:.||:..|.....:..:.||:..:..:| .|.||   
  Fly   147 PTLPHPLDTRFLPFNPAA-----AGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHE 206

Human    73 ----------PKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATA--AATGPA 125
                      .:|:|..:..||..:|:..|.|                ||.......  ..:|.:
  Fly   207 DQANPGMAQLQEPTPPQAHSSPAKSGSHSPME----------------PALDVGMDEDFECSGDS 255

Human   126 C-----------------------LSHKESLEIADGSG----------GG-------------SR 144
            |                       .::.:|.:.:|..|          ||             ||
  Fly   256 CSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSR 320

Human   145 RLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQN 209
            |.|||:|:.||||||:|||..|||....|.:||..|.|:|.|||:||||||.|.||   .|....
  Fly   321 RRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR---VKAGLT 382

Human   210 SEGKCKSLEDSEKVEEDEEEKTLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQSFPV 274
            |.|                               |.|.|.|               :|.....|:
  Fly   383 SHG-------------------------------LGRNGTT---------------SGTKIVVPI 401

Human   275 SPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDA 339
             |:..|...::. |||.         :.:.|.:|...|..:.|...::..|..||..     ::|
  Fly   402 -PVHVNRFAVRS-QHQQ---------LEKMCLSGPKPDLRKKLSAEAIGGFEKFSGS-----TNA 450

Human   340 VSPS 343
            .|||
  Fly   451 SSPS 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXA2NP_006726.1 Antp-type hexapeptide 94..99 1/5 (20%)
Homeobox 147..199 CDD:306543 32/52 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.