DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA1 and zen2

DIOPT Version :10

Sequence 1:NP_005513.2 Gene:HOXA1 / 3198 HGNCID:5099 Length:335 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:103 Identity:44/103 - (42%)
Similarity:61/103 - (59%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   208 MKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQ 272
            :.|:..|..|.:..|     :....||.|::.||.|||:|||.||||.|.||:||:..|.|.|.|
  Fly    27 LNVEAAPTATTRSSE-----KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQ 86

Human   273 VKIWFQNRRMKQKK-REKEGLLPISPATPPGNDEKAEE 309
            |||||||||||.|| ..::|.:.....:.|.:.:.:|:
  Fly    87 VKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSED 124

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HOXA1NP_005513.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..80
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 75..203
COG5576 176..>286 CDD:227863 39/77 (51%)