DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXA1 and zen2

Sequence 1:NP_005513.1 Gene:HOXA1 HGNCID:5099 Length:335 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:103 Identity:44/104 (42%)
Similarity:61/104 (59%) Gaps:6/104 (6%)


Human   208 MKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQ 272
            :.|:..|..|.:..|     :....||.|::.||.|||:|||.||||.|.||:||:..|.|.|.|
  Fly    27 LNVEAAPTATTRSSE-----KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQ 86

Human   273 VKIWFQNRRMKQKK-REKEGLLPISPATPPGNDEKAEE 309
            |||||||||||.|| ..::|.:.....:.|.:.:.:|:
  Fly    87 VKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSED 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXA1NP_005513.1 Interaction with OGT. {ECO:0000250|UniProtKB:P09022} 75..203
Abdominal-A 176..>286 CDD:332641 40/78 (51%)
Antp-type hexapeptide 204..209 0/1 (0%)
Homeobox 233..285 CDD:306543 35/52 (67%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/53 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.