DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXA1 and unpg

Sequence 1:NP_005513.1 Gene:HOXA1 HGNCID:5099 Length:335 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:259 Identity:80/260 (31%)
Similarity:102/260 (39%) Gaps:52/260 (20%)


Human    75 PQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALN-QEADVSGGYPQCAPAVYSGNLSSP 138
            |.|.|:.....|..:..|..      ...| .|::|.|.. ...|:|  |.:.|..:....:.|.
  Fly   134 PHPPTHALEKQLPPTLPHPL------DTRF-LPFNPAAAGVAPTDLS--YRRLAELMNQDYVHSL 189

Human   139 MVQHHHHHQGYAG------GAVGSPQYIHHSYGQEHQSLALATYNNSLSP-LHASHQE------- 189
            .|.....|...||      ...|..|....:..|.|.|.|.:..::.:.| |.....|       
  Fly   190 SVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGD 254

Human   190 ACRSPASETSSPAQTFDWMKVKRNPPKTGKVG-------------EYGYLG----QPNAV----- 232
            :| |..|.|.||......|...||...|....             |.|.:|    |.|..     
  Fly   255 SC-SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK 318

Human   233 ----RTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGL 292
                ||.||::||.|||:|||..|||:...|.:||.||:|:|.||||||||||.|. ||.|.||
  Fly   319 SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGL 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXA1NP_005513.1 Interaction with OGT. {ECO:0000250|UniProtKB:P09022} 75..203 33/143 (23%)
Abdominal-A 176..>286 CDD:332641 51/144 (35%)
Antp-type hexapeptide 204..209 1/5 (20%)
Homeobox 233..285 CDD:306543 33/52 (63%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.